SecReT6
Protein ID: 146305142
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0101
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]98483..98965 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA4XNF9
KEGG IDpmy:Pmen_0101
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-41, Aligned region: 14..149
Protein Sequence: 160 a.a.     [Download]
>gi|146305142|ref|YP_001185607.1| unnamed protein product [Pseudomonas mendocina ymp]
MPRLLSLAFIAALLSLAGCAALSPYSSMTKLDLSLAGSDQLNPDLHGRPSPIVLRLMELKHPVAFENADF
FSLYQRPKEALAPDLVTLEELELRPGETRELKLSVGEGSRYVGVLAAYRDLPEANWRYVIAIDEQQRNQA
RLRLDERGIRNLDAEQERSR
 
Nucleotide Sequence: 483 bp     [Download]
>gi|146305042|ref|NC_009439.1|:98483-98965 Pseudomonas mendocina ymp chromosome, complete genome
ATGCCTCGCCTGCTTTCCCTCGCCTTCATCGCCGCGCTGCTGAGCCTGGCCGGCTGCGCCGCGCTGTCGC
CCTATTCGAGCATGACCAAGCTGGACCTCAGCCTGGCCGGCAGCGACCAGCTCAACCCGGACCTGCACGG
CCGCCCCTCGCCCATCGTGCTGCGCCTGATGGAGCTCAAGCACCCGGTGGCCTTCGAGAATGCCGATTTC
TTCTCCCTCTACCAGCGTCCCAAGGAGGCCCTGGCGCCCGACCTGGTGACCCTCGAGGAACTGGAGCTGC
GCCCGGGCGAGACCCGCGAGCTGAAACTCTCGGTGGGTGAAGGCAGCCGCTACGTCGGCGTGCTCGCCGC
CTACCGCGACCTGCCGGAAGCCAACTGGCGCTACGTCATCGCCATCGACGAGCAGCAGCGCAACCAGGCG
CGCCTGCGCCTCGACGAGCGCGGCATCCGCAACCTCGATGCCGAGCAGGAGCGCAGCCGATGA