SecReT6
Protein ID: 146305144
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0103
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]100296..101177 [+]
Producthypothetical protein
NoteTssL
UniProt IDA4XNG1
KEGG IDpmy:Pmen_0103
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-72, Aligned region: 62..267
Protein Sequence: 293 a.a.     [Download]
>gi|146305144|ref|YP_001185609.1| unnamed protein product [Pseudomonas mendocina ymp]
MTIKEMEYGQDDKTVILNRKGEARAESPLTDFSAPPKFEQLEERMIFAARLRPAESFNISLNPLVAAASA
LLSEVVRLKHSFESEDLDALNQRLTREIKLFEHRALHDGAESSQVMAARYVLCTVVDEAVVTTPWGNESQ
WSQMSLLSSFHNETFGGEKFFQLLERLSRNPVKHLPMLELMYLCLSLGFEGKYRVLPRGMLELEAVRDSL
YRQIRQLRGDVPREVSPHWQGLKDTRRRLVRIVPWWLVALFTLMCLVMMYAGFAWVLGEQRDTVLKPYQQ
LDPASGVSMDDVK
 
Nucleotide Sequence: 882 bp     [Download]
>gi|146305042|ref|NC_009439.1|:100296-101177 Pseudomonas mendocina ymp chromosome, complete genome
ATGACCATCAAGGAAATGGAATACGGCCAGGATGACAAGACGGTCATCCTCAACCGCAAGGGCGAAGCCC
GCGCCGAAAGCCCGCTGACCGACTTCAGCGCGCCACCGAAATTCGAGCAGCTGGAAGAACGCATGATCTT
CGCCGCGCGCCTGCGCCCGGCGGAGAGCTTCAACATCAGCCTCAACCCGCTGGTGGCGGCGGCCTCCGCG
CTGCTCTCGGAAGTGGTGCGGCTCAAGCACAGCTTCGAAAGCGAGGACCTGGACGCCCTCAACCAGCGCC
TGACCCGCGAGATCAAGCTGTTCGAACACCGCGCCCTGCACGACGGCGCGGAAAGCAGCCAGGTGATGGC
CGCGCGCTACGTGCTGTGCACCGTGGTCGACGAAGCGGTGGTGACCACGCCCTGGGGCAACGAGAGCCAG
TGGTCGCAGATGAGCCTGCTGTCCTCCTTCCACAACGAGACCTTCGGCGGCGAGAAGTTCTTCCAGCTGC
TCGAGCGCCTGTCGCGCAACCCGGTCAAGCACCTGCCGATGCTGGAGCTGATGTACCTGTGCCTGTCGCT
CGGCTTCGAGGGCAAGTACCGCGTGCTGCCGCGCGGCATGCTCGAGCTGGAAGCGGTGCGCGACAGCCTC
TACCGGCAGATCCGTCAGCTGCGCGGCGATGTGCCGCGCGAAGTCTCGCCGCACTGGCAGGGCCTCAAGG
ACACCCGCCGGCGCCTGGTGCGCATCGTGCCGTGGTGGCTGGTGGCGCTGTTCACCCTGATGTGCCTGGT
GATGATGTACGCCGGCTTCGCCTGGGTGCTCGGCGAGCAGCGCGACACCGTCCTCAAGCCGTATCAGCAA
CTCGACCCGGCCTCGGGTGTCAGCATGGATGACGTGAAATGA