SecReT6
Protein ID: 146305148
SecReT6 ID206
T6SS typei1
Gene symbol-
Locus tagPmen_0107
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]106434..108515 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4XNG5
KEGG IDpmy:Pmen_0107
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-72, Aligned region: 29..330
Phage_base_V [PF04717], Evalue: 2.90E-24, Aligned region: 390..482
DUF2345 [PF10106], Evalue: 3.50E-06, Aligned region: 554..586
DUF2345 [PF10106], Evalue: 3.50E-06, Aligned region: 593..635
Protein Sequence: 693 a.a.     [Download]
>gi|146305148|ref|YP_001185613.1| unnamed protein product [Pseudomonas mendocina ymp]
MLNPANETHFSLTIEGVEHDLQVLEFNGREAISQPYRFDVELISERPDLDLTSLLHQRAFLAFSPNGDGI
HGLIHRVEQGESGKRLTRYRLAIVPQLAYLAHRTNQRIFQHLTVPQIIAQVLEEHGIVEGRYQFQLGPSV
YPQREYCVQYDESDLHFVQRLCEEEGIHYHFQHSASGHVLTFGDDQTAFAKLGQPTPYIQDSGMTADDPV
IKRLALRLETRTRSTARRDYDFEQPRLLLEAAYQGEQAGENDGLPDLEDYDYPGRYTDRTRGKHLAKRAL
ERHRADYQQLQGQSDQPRLVTGHLLEISEHPRREWNDLWLLTEVLHEGKQPQVLEESVLNLPSPPGRGAG
GEGTSGDTDFTQGYRNRFLATPWDVPFRPPLVHPKPRVLGSQSAVVTGPAGEEIHCDEYGRVKVQFFWDR
EGQADEKTSCWLRVSSSWAGDRYGAITIPRIGMEVLVTFLEGDPDQPLVTGCLYHAEHLVPYDLPANKTR
SVFKTLSSPGGGGYNELRIEDRKGAEQIYIHAQRNWDENIEHDQKIRVGNERHDTVEKNSYTELLAEEHL
TVTADRKVEVKPQDHLTVATDQHIKLGTAQLTKAGREIHLKAGQKMVIEAGIELTIKAGGSFIKLDPGGI
TISGPLARINAGGSPGKGSGLKIKPPVLPGMADSDKAGSLLEQAVGNALTPKAKPKRTLNFSG
 
Nucleotide Sequence: 2082 bp     [Download]
>gi|146305042|ref|NC_009439.1|:106434-108515 Pseudomonas mendocina ymp chromosome, complete genome
ATGTTGAACCCGGCCAATGAAACCCATTTCAGCCTGACCATCGAAGGCGTCGAGCACGATCTGCAGGTGC
TCGAATTCAACGGCCGCGAGGCCATCAGCCAGCCCTATCGCTTCGACGTCGAGCTGATCAGCGAACGCCC
GGATCTCGATCTGACCAGTCTGCTGCATCAGCGCGCCTTCCTCGCCTTCAGCCCCAATGGCGACGGCATC
CACGGCCTGATCCACCGGGTCGAGCAGGGCGAGTCCGGCAAACGCCTGACCCGCTATCGCCTGGCCATCG
TGCCGCAGCTCGCCTACCTGGCGCACCGCACCAACCAGCGCATCTTCCAGCACCTGACGGTGCCGCAGAT
CATCGCTCAGGTGCTGGAAGAACATGGCATCGTGGAGGGCCGCTACCAGTTCCAGCTAGGCCCCAGCGTC
TACCCGCAGCGCGAGTACTGCGTGCAGTACGACGAGAGCGACCTGCACTTCGTCCAGCGCCTGTGCGAGG
AAGAAGGCATCCACTACCACTTCCAGCACAGCGCAAGCGGCCATGTGCTGACCTTCGGCGACGACCAGAC
CGCCTTCGCCAAGCTCGGCCAGCCTACGCCCTATATCCAGGACAGCGGCATGACCGCCGACGATCCGGTG
ATCAAGCGCCTGGCCCTGCGCCTGGAAACCCGCACCCGCAGCACCGCCCGCCGCGACTACGACTTCGAGC
AGCCGAGGCTGCTGCTGGAGGCGGCCTACCAGGGCGAGCAGGCCGGCGAAAACGACGGCCTGCCCGATCT
GGAAGACTACGACTACCCCGGCCGCTACACCGACCGCACGCGCGGCAAGCACCTGGCCAAACGCGCCCTG
GAGCGCCACCGCGCCGACTACCAGCAACTGCAAGGCCAGAGCGACCAGCCGCGGCTGGTTACGGGGCATC
TGCTGGAAATCTCCGAACACCCGCGCCGCGAATGGAACGACCTCTGGCTGCTCACCGAAGTGCTGCACGA
AGGTAAACAGCCGCAGGTGCTGGAGGAGTCGGTGTTGAACCTCCCCTCTCCCCCCGGGAGAGGGGCCGGG
GGTGAGGGTACTTCAGGCGACACCGACTTCACCCAAGGCTACCGCAACCGCTTTCTCGCCACCCCCTGGG
ACGTGCCCTTCCGACCGCCCTTGGTCCACCCCAAACCGCGCGTCCTCGGCAGCCAGAGCGCCGTGGTCAC
GGGCCCTGCCGGCGAGGAAATCCACTGCGACGAATACGGTCGAGTGAAGGTGCAATTCTTCTGGGATCGC
GAAGGCCAGGCCGACGAGAAGACCAGCTGCTGGCTGCGCGTCAGCTCCAGCTGGGCTGGCGATCGCTACG
GCGCCATCACCATCCCGCGCATCGGCATGGAAGTGCTGGTCACCTTCCTCGAAGGCGACCCCGATCAACC
GCTGGTCACCGGCTGCCTCTACCACGCCGAACACCTGGTGCCCTACGACCTGCCGGCAAACAAGACCCGC
AGCGTGTTCAAGACCCTGAGCAGCCCTGGCGGTGGCGGCTACAACGAACTGCGCATCGAGGATCGCAAGG
GCGCCGAGCAGATCTACATCCACGCCCAGCGCAACTGGGACGAGAACATCGAGCACGACCAGAAGATCCG
CGTCGGCAACGAACGCCACGACACCGTGGAGAAGAACAGCTACACCGAATTGCTGGCCGAGGAGCACCTC
ACCGTCACCGCCGACCGCAAGGTCGAGGTCAAGCCCCAGGACCACCTGACGGTGGCCACCGACCAACACA
TCAAGCTGGGCACCGCGCAACTGACCAAGGCCGGCCGCGAGATCCACCTGAAGGCCGGGCAGAAGATGGT
CATCGAAGCCGGCATCGAACTGACGATCAAGGCCGGCGGCAGCTTTATCAAACTCGACCCCGGCGGCATC
ACCATCTCCGGCCCGCTGGCCAGGATCAACGCCGGCGGTTCGCCAGGCAAGGGCTCGGGGCTCAAGATCA
AACCGCCGGTGCTGCCGGGTATGGCGGATAGCGACAAGGCGGGGAGTTTGTTGGAGCAGGCGGTTGGTAA
TGCGCTGACGCCCAAGGCAAAACCCAAACGCACGCTGAACTTCTCCGGTTAA