SecReT6
Protein ID: 146307340
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2315
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2553488..2554177 [-]
Producthypothetical protein
NoteTagF
UniProt IDA4XUQ7
KEGG IDpmy:Pmen_2315
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 1.20E-49, Aligned region: 4..140
Protein Sequence: 229 a.a.     [Download]
>gi|146307340|ref|YP_001187805.1| unnamed protein product [Pseudomonas mendocina ymp]
MTVGFYGKLASRGDFIHRGLPSAFIESWDAWLATGIATSQQELGPAWLDAYLVSPLWRFALAPGLVSSGA
VTGVMMPSVDRVGRYFPLTIACLLDADADLGSLLGGPDAWYEQAEALLLSTLEEGSECEAFEAAVAALGD
PPCSRRRPRTPGFRQMHFGVASPAERLAVLAQLTCEGASLWWGRGSEHVAAGLLCCAGMPAAQAFSGLLL
GADVSPAPSLAAQLQSESR
 
Nucleotide Sequence: 690 bp     [Download]
>gi|146305042|ref|NC_009439.1|:c2554177-2553488 Pseudomonas mendocina ymp chromosome, complete genome
ATGACGGTGGGCTTCTACGGCAAGCTGGCGAGCCGCGGCGACTTCATCCATCGCGGCCTGCCCAGCGCCT
TCATCGAATCCTGGGACGCCTGGCTGGCCACGGGCATCGCCACCAGCCAGCAGGAGCTGGGTCCGGCCTG
GCTCGATGCCTATCTGGTCAGCCCGCTGTGGCGCTTCGCCCTGGCGCCGGGCCTGGTAAGTAGCGGAGCG
GTCACCGGGGTGATGATGCCCAGCGTCGACCGGGTCGGTCGTTATTTCCCGCTGACCATCGCCTGCCTGC
TGGACGCCGATGCCGACCTGGGCTCGCTGCTCGGCGGCCCGGACGCCTGGTACGAGCAGGCCGAGGCGTT
GTTGCTGTCGACGCTGGAGGAAGGCAGCGAATGCGAGGCCTTCGAGGCCGCGGTGGCCGCCCTTGGCGAT
CCGCCCTGCAGCCGGCGCAGGCCGCGCACGCCAGGCTTTCGGCAGATGCATTTCGGTGTCGCCAGCCCGG
CCGAGCGCCTGGCCGTGCTGGCTCAGCTCACCTGTGAAGGCGCCAGTCTGTGGTGGGGGCGCGGCTCGGA
GCATGTCGCCGCCGGCCTGCTGTGCTGCGCCGGGATGCCGGCAGCGCAGGCGTTCAGTGGCCTGTTGCTG
GGAGCGGATGTATCGCCGGCTCCCAGCCTGGCCGCGCAGTTGCAGAGCGAGAGCCGATGA