SecReT6
Protein ID: 146307342
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2317
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2557686..2559047 [-]
Producthypothetical protein
NoteTssL
UniProt IDA4XUQ9
KEGG IDpmy:Pmen_2317
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.40E-68, Aligned region: 70..275
OmpA [PF00691], Evalue: 4.10E-18, Aligned region: 343..441
Protein Sequence: 453 a.a.     [Download]
>gi|146307342|ref|YP_001187807.1| unnamed protein product [Pseudomonas mendocina ymp]
MHPIDDPFGGPPGNGGGGSGPGNDRTMIMPRPGGRAPEPPAGQPRPAPAAGPAPAMPGAPLPSSLAQGLN
PLERAAAPLLALLTRLRNTISHPMPASLRAQLLAYLRQFEEQAKGAGVPQDEVMLSRYVLCTALDEAVLS
TPWGSGSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNARQKLNILELLYLCMCLGFEGRYRVMNDGRSQ
LEALRERTAATIRSVRGEYERGLSPRWRGVSAVRDRLSQFVPPWVGIAVCLALLLLLLFGLRLKLASDAE
PVFRNIHALGEIPVQTIDRPPVQPKLIERPRLARFLEDDIRAQRVAVEDAVDRSVVTIRGDELFASGSAS
ISDNLQPLLLRIAEAIRQVKGNVLVTGHSDDRPIATLRYPSNWKLSQDRAQQVMDVLAARSGQPERFTAE
GRSDTEPVASNESAAGRARNRRVEITVFAEGNL
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|146305042|ref|NC_009439.1|:c2559047-2557686 Pseudomonas mendocina ymp chromosome, complete genome
ATGCATCCGATCGATGATCCGTTCGGCGGCCCGCCGGGCAACGGTGGTGGTGGCTCAGGCCCTGGCAACG
ACCGCACCATGATCATGCCGCGCCCCGGCGGACGGGCGCCTGAGCCGCCCGCCGGCCAGCCCCGCCCCGC
GCCTGCAGCCGGGCCGGCGCCGGCCATGCCTGGCGCGCCCCTGCCTAGCAGCCTGGCCCAGGGCCTCAAC
CCGCTGGAGCGCGCAGCGGCGCCGCTGCTGGCGCTGCTGACGCGTTTGCGCAACACCATTTCCCACCCGA
TGCCGGCCAGCCTGCGCGCGCAATTGCTGGCCTATCTGCGTCAGTTCGAGGAACAGGCCAAGGGCGCCGG
CGTGCCGCAGGACGAGGTCATGCTCAGCCGCTACGTGCTGTGCACCGCGCTGGACGAGGCGGTGCTCAGC
ACGCCCTGGGGCAGTGGCAGCGACTGGGGCAAGCAGAGCCTGCTGATCACCCTGCACAACGAGGCCTGGG
GCGGTGAGAAGGTCTTCCAGCTACTCGAGCACTGCCTGCAGAACGCCCGGCAGAAGCTGAACATTCTCGA
GCTGCTGTACCTGTGCATGTGCCTGGGTTTCGAGGGGCGCTACCGGGTGATGAACGACGGCCGCAGCCAG
CTCGAAGCCCTGCGCGAACGCACCGCAGCGACCATCCGCAGCGTCCGTGGCGAGTACGAACGCGGTCTGT
CGCCGCGCTGGCGGGGCGTCAGCGCGGTGCGCGATCGCCTGTCGCAGTTCGTCCCGCCCTGGGTCGGCAT
CGCCGTATGCCTGGCGCTGCTGCTGCTTCTGCTGTTCGGCCTGCGCCTGAAGCTGGCCAGCGACGCCGAA
CCGGTGTTCCGCAATATCCACGCGTTGGGCGAGATCCCGGTGCAGACCATCGACCGGCCGCCGGTACAGC
CCAAGCTGATCGAACGCCCGCGTCTGGCACGTTTTCTCGAAGACGACATCCGCGCCCAGCGCGTCGCCGT
GGAGGATGCGGTGGATCGTTCGGTGGTGACCATCCGTGGCGACGAGCTGTTCGCTTCCGGCAGCGCCAGC
ATTTCCGACAACCTGCAGCCGCTGCTGCTGCGCATTGCCGAGGCCATCCGCCAGGTCAAGGGCAACGTGC
TGGTCACCGGTCACAGTGACGACCGGCCCATCGCCACCTTGCGTTATCCCTCCAACTGGAAGCTGTCGCA
GGACCGTGCGCAGCAGGTCATGGACGTCCTGGCCGCGCGCAGCGGCCAGCCGGAACGCTTCACCGCCGAA
GGGCGCAGCGACACCGAACCGGTGGCCTCCAACGAGAGCGCCGCCGGCCGCGCACGCAACCGCCGGGTGG
AGATCACCGTATTCGCGGAGGGCAACCTGTGA