SecReT6
Protein ID: 146307343
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2318
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2559054..2560388 [-]
Producthypothetical protein
NoteTssK
UniProt IDA4XUR0
KEGG IDpmy:Pmen_2318
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.40E-156, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|146307343|ref|YP_001187808.1| unnamed protein product [Pseudomonas mendocina ymp]
MSWNNRVVWSEGMFLRPQHLQQHDRYLETLVDSRCRPMFAGGWGFSELQLDAALLTQGKLAILSARGVLP
DGTPFDIPGEDVAPTPLIVDPEMRDKLIYLGLPLKRAGTRDTVEEGEALGGARYISQVREVRDDNAPFES
RAPLAIGGKALRLLTERDGLGEYACIGVVRVVEKRADNALLLDESYIPPLLDVAASQPLAAFRSELQGLL
HQRGEALAGRVVASGAGGASEIADFLLLQLVNRAEPLISHLARLSPLHPEAFYREAVALAGEFATFSSSG
RRPAEYPAYEHDDLAASFAPVIRELRQALSMVIDSRATPIPIVEKSYGVHVAMLADKNLLQGASFVLVVR
ADVPAENLRSLFPQQAKVGSVEHIRDLVNLQLPGIALLPMPVAPRQIPYHAGSSYFELDRGSDHWKQLAN
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|146305042|ref|NC_009439.1|:c2560388-2559054 Pseudomonas mendocina ymp chromosome, complete genome
ATGTCCTGGAATAACCGAGTGGTGTGGTCCGAGGGAATGTTCCTGCGCCCGCAACACCTGCAGCAGCATG
ATCGCTACCTGGAAACGCTGGTCGACAGCCGCTGCCGGCCGATGTTCGCCGGCGGCTGGGGCTTCTCCGA
ACTGCAGCTGGATGCGGCGCTGCTGACCCAGGGCAAGCTGGCCATTCTCAGCGCCCGTGGCGTGTTGCCC
GACGGAACGCCCTTCGACATCCCCGGCGAGGACGTGGCGCCGACGCCGCTGATCGTCGACCCGGAAATGC
GCGACAAGCTGATCTACCTCGGCCTGCCGCTCAAGCGCGCCGGCACCCGCGACACCGTGGAGGAGGGCGA
AGCCCTCGGCGGCGCCCGCTACATCAGCCAGGTGCGCGAGGTGCGCGACGACAACGCGCCGTTCGAGAGC
CGCGCGCCGCTGGCCATCGGCGGCAAGGCGCTGCGCCTGCTCACCGAGCGCGATGGCCTCGGCGAGTACG
CCTGCATCGGCGTGGTGCGGGTGGTGGAAAAGCGTGCCGACAACGCCTTGCTGCTGGACGAGAGTTACAT
CCCGCCGTTGCTGGACGTCGCCGCCTCGCAGCCGCTGGCGGCCTTTCGCAGCGAACTGCAGGGCCTGCTG
CATCAGCGCGGCGAGGCATTGGCGGGCAGGGTGGTGGCCTCCGGTGCCGGCGGCGCCTCGGAAATCGCCG
ACTTTCTCCTGCTGCAGCTGGTCAACCGCGCCGAGCCGCTGATCAGCCACCTGGCCCGGCTCAGCCCGCT
GCACCCGGAGGCCTTCTACCGCGAGGCGGTGGCGCTGGCCGGCGAATTCGCCACCTTTTCCAGCAGCGGT
AGGCGCCCGGCCGAGTACCCGGCCTACGAGCACGACGACCTGGCGGCCAGCTTCGCCCCGGTGATCCGCG
AGCTGCGCCAGGCGTTGTCGATGGTCATCGACAGCCGCGCCACGCCGATTCCCATCGTCGAGAAATCCTA
CGGCGTGCACGTGGCCATGCTGGCCGACAAGAACCTGCTGCAGGGCGCCAGCTTCGTCCTGGTGGTGCGC
GCCGACGTGCCGGCGGAGAACCTGCGCAGCCTGTTCCCGCAGCAGGCCAAGGTCGGCTCGGTGGAGCACA
TCCGCGACTTGGTCAATCTGCAGCTGCCGGGCATCGCGCTGCTGCCGATGCCGGTGGCACCACGGCAGAT
TCCCTATCACGCCGGCTCCAGCTACTTCGAGCTGGATCGCGGCAGCGACCATTGGAAGCAGTTGGCCAAT
TCGGGAGGCTTCGCCTTCCATATCGCTGGCCAGTTCCCCGGCTTGAACCTGGCCTTCTGGGCCATCCGAG
GGTAG