SecReT6
Protein ID: 146307344
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2319
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2560409..2560876 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA4XUR1
KEGG IDpmy:Pmen_2319
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.90E-39, Aligned region: 10..145
Protein Sequence: 155 a.a.     [Download]
>gi|146307344|ref|YP_001187809.1| unnamed protein product [Pseudomonas mendocina ymp]
MPRIFWGVLALLLTACASEPPPPVPTVVRLQLQATTDLNPSGSGQPAPVRVRLYELKSGAIFSRADYFSL
VEAANATLGSDLVEQDELLIQPGEQLILDRTLDEQSRLLGFVVAYRDLDDSVWRQLVNIPPHQTSILNVS
LSARAVSAVPATPAK
 
Nucleotide Sequence: 468 bp     [Download]
>gi|146305042|ref|NC_009439.1|:c2560876-2560409 Pseudomonas mendocina ymp chromosome, complete genome
ATGCCAAGGATATTCTGGGGAGTGCTGGCTCTGCTGTTGACTGCCTGCGCTTCGGAACCGCCACCGCCGG
TACCTACCGTCGTGCGTCTGCAACTGCAGGCCACTACCGACCTCAACCCGTCCGGCAGCGGCCAGCCGGC
GCCGGTGCGGGTACGCCTGTATGAGCTCAAGAGCGGCGCGATATTCAGCCGCGCCGACTATTTCTCCCTG
GTGGAGGCCGCCAACGCCACCCTCGGCAGCGACCTGGTGGAGCAGGACGAACTGCTGATCCAGCCCGGCG
AACAGCTGATTCTCGACCGTACCCTGGACGAGCAGAGCCGCCTGCTCGGCTTCGTGGTCGCCTACCGCGA
CCTGGACGATTCGGTGTGGCGGCAACTGGTCAACATCCCGCCGCACCAGACCAGCATCCTCAACGTCAGC
CTCAGCGCCCGCGCGGTCAGCGCCGTGCCTGCGACACCGGCCAAGTAG