SecReT6
Protein ID: 146307345
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2320
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2560951..2562393 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDA4XUR2
KEGG IDpmy:Pmen_2320
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-15, Aligned region: 29..97
Protein Sequence: 480 a.a.     [Download]
>gi|146307345|ref|YP_001187810.1| unnamed protein product [Pseudomonas mendocina ymp]
MPLRLTITSYHKLTPGQRAEVELDQGELKIGRNQDNDWVLPDPERLVSGQHCVIQFRGGTYYLTDTSTNG
VQLVNAGIRMHRGNSEPLHDGELIRLGEYDILVHLSSANFSTETPVMASSDPFTGFDALMSRQGGSAAVF
PEPAAPSTFSVQMQPGGSPLDTKPDLFDFLAAPAVPPPTLPDHVPAERHDFRPPQPQQPPQAPAVDAPAV
SSAPAIPADWDPFADLGIAPASPPAPPQPIPPAPPVAAPEPVQAKALEPQPAAIAASAKPAAPSSAAPAP
AAAMNSDALEAFLRGAGVDQLRIDRGEALAQMEAIGRSYRQMVEGLVDVLRARASLKGEFRMAQTMIQPV
ENNPLKFAPNVEEALLLLLRSGNQAFMPADQAIAESFDDLRAHQLAVMAGVQAAIKHLLKRFEPATLEAR
LNKPSGLGGLLPGARQSKYWELFTETYASISREAEDDFQDLFGREFSRAYEEHSAKLRRS
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|146305042|ref|NC_009439.1|:c2562393-2560951 Pseudomonas mendocina ymp chromosome, complete genome
ATGCCACTGCGTCTGACCATCACCAGTTATCACAAGCTGACACCCGGGCAGCGCGCGGAGGTGGAACTCG
ACCAGGGAGAGCTCAAGATCGGGCGTAATCAGGACAATGACTGGGTTCTGCCGGACCCCGAGCGCCTGGT
TTCCGGACAACACTGCGTGATCCAGTTTCGCGGTGGCACCTACTATCTGACCGACACCAGCACCAATGGC
GTGCAACTCGTCAACGCGGGCATCCGCATGCATCGCGGCAACAGCGAACCGCTGCACGATGGCGAGCTGA
TTCGCCTCGGTGAATACGACATTCTGGTGCATCTGAGCAGCGCCAATTTTTCGACAGAAACGCCGGTGAT
GGCCAGTAGCGATCCCTTCACCGGCTTCGATGCGCTCATGAGTCGCCAGGGCGGCAGCGCTGCGGTTTTC
CCCGAGCCGGCAGCGCCTTCCACCTTCTCGGTGCAGATGCAGCCCGGCGGTTCGCCACTGGATACCAAAC
CCGATCTGTTCGATTTTCTCGCCGCGCCGGCGGTGCCGCCGCCTACCTTGCCGGACCATGTACCGGCCGA
GCGCCACGACTTTCGCCCACCGCAGCCGCAACAACCGCCCCAGGCGCCGGCTGTGGATGCCCCAGCCGTG
TCGTCGGCCCCGGCCATCCCAGCGGACTGGGACCCGTTCGCCGACCTGGGCATCGCCCCGGCGTCGCCGC
CCGCGCCGCCGCAGCCGATTCCACCAGCCCCGCCGGTGGCAGCGCCTGAACCCGTGCAAGCCAAGGCTCT
CGAGCCTCAGCCAGCGGCGATTGCCGCCAGCGCCAAGCCGGCCGCGCCGAGCAGCGCCGCCCCTGCACCT
GCAGCAGCCATGAACAGCGATGCCCTGGAGGCATTTCTGCGTGGCGCCGGTGTAGACCAGCTGCGCATCG
ACCGTGGCGAGGCCCTGGCGCAGATGGAGGCCATCGGTCGCAGCTATCGGCAGATGGTCGAGGGCCTGGT
GGACGTGTTGCGTGCCCGGGCCAGCCTCAAGGGCGAGTTCCGCATGGCGCAGACCATGATCCAGCCGGTG
GAAAACAACCCGCTGAAATTCGCGCCGAACGTGGAAGAGGCGCTGCTGTTGCTGCTGCGCTCGGGCAATC
AGGCCTTCATGCCGGCCGACCAGGCCATCGCCGAGAGTTTCGATGACCTGCGTGCTCACCAACTTGCGGT
AATGGCGGGAGTGCAGGCAGCAATAAAACATCTGTTGAAGCGCTTCGAGCCGGCAACTCTCGAGGCGCGC
CTGAACAAACCCTCCGGACTTGGCGGTTTGTTGCCCGGTGCGCGCCAATCCAAGTACTGGGAGTTGTTCA
CGGAAACCTACGCCAGCATCTCCCGCGAGGCGGAAGACGATTTCCAGGACCTGTTCGGTCGCGAATTCAG
TCGAGCATACGAAGAGCACAGCGCAAAGTTGCGGAGAAGTTAA