SecReT6
Protein ID: 146307346
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2321
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2562769..2563791 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA4XUR3
KEGG IDpmy:Pmen_2321
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-21, Aligned region: 53..113
ImpA-rel_N [PF06812], Evalue: 2.00E-21, Aligned region: 155..168
Protein Sequence: 340 a.a.     [Download]
>gi|146307346|ref|YP_001187811.1| unnamed protein product [Pseudomonas mendocina ymp]
MVDVQQLLTAISPDSPSGDDLEYDAAFLELERTAQGQPERQMGDSVLPAEPPDWRQVREQSAALFARSKD
LRIANYYLQSSIVLDGVAGLAQALQLIQALLQQFWDSLHPVLDADDDNDPTFRINALAGISAEPVVRLLW
DMPLIRSRAFGTVTLRAALNASGLQRFTSESMSLEQVGAAFRDSDAEQVEACRAAITAAQAALQGIEREV
NERVGSDRGAELGAIKQLLRHAVHIVNEHAPAAGGEQASSEQPAPAEPGEVAAVSASAPRPSGEINHRDD
VLKALDRILAYYARHEPSSPVPVLLNRAKTLVNADFATIVRNLIPDGFSQFERFRGPEGE
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2562769-2563791 Pseudomonas mendocina ymp chromosome, complete genome
GTGGTGGACGTACAACAGCTTTTGACTGCCATCTCACCCGACTCGCCGAGCGGGGATGACCTCGAATACG
ACGCCGCTTTTCTCGAACTGGAGCGCACCGCACAAGGCCAACCCGAACGTCAGATGGGCGACTCGGTATT
GCCTGCCGAGCCGCCGGACTGGCGCCAGGTCCGTGAGCAGAGCGCAGCACTGTTCGCGCGCAGCAAGGAC
CTGCGCATCGCCAATTACTACCTGCAGAGCAGCATCGTGCTGGACGGCGTCGCCGGCCTGGCCCAGGCGC
TGCAATTGATCCAGGCGTTGCTGCAGCAGTTCTGGGACAGCCTTCACCCCGTGCTGGACGCCGACGACGA
CAACGACCCCACCTTCCGCATCAACGCCCTGGCCGGCATCAGCGCCGAACCGGTGGTGCGTCTGCTGTGG
GACATGCCGCTGATCCGTTCACGCGCCTTCGGCACCGTCACCCTGCGTGCAGCGCTCAATGCCAGCGGGC
TGCAGCGCTTCACCAGCGAGAGCATGAGCCTCGAGCAGGTCGGCGCCGCCTTTCGCGACAGCGACGCGGA
ACAGGTCGAGGCCTGTCGCGCCGCGATCACGGCCGCCCAGGCGGCGCTGCAGGGCATCGAGCGCGAAGTC
AACGAGCGCGTGGGCTCCGATCGCGGAGCCGAACTCGGCGCGATCAAGCAGCTGTTGCGCCACGCCGTGC
ACATCGTCAACGAGCATGCGCCCGCCGCAGGCGGCGAGCAGGCCAGCTCCGAGCAGCCTGCGCCCGCCGA
GCCAGGCGAAGTCGCAGCCGTCAGTGCCTCGGCGCCGCGGCCGAGCGGCGAGATCAACCATCGCGACGAT
GTGCTCAAGGCGCTCGACCGCATCCTCGCCTATTACGCCAGGCACGAGCCCTCCAGCCCGGTTCCGGTGC
TGCTCAACCGTGCCAAGACCCTGGTCAACGCCGACTTCGCCACCATCGTGCGCAACCTGATCCCGGACGG
CTTTTCCCAGTTCGAACGCTTCCGGGGACCGGAAGGCGAATAG