SecReT6
Protein ID: 146307347
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2322
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2563855..2564370 [+]
Producthypothetical protein
NoteTssB
UniProt IDA4XUR4
KEGG IDpmy:Pmen_2322
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-60, Aligned region: 10..163
Protein Sequence: 171 a.a.     [Download]
>gi|146307347|ref|YP_001187812.1| unnamed protein product [Pseudomonas mendocina ymp]
MANPSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLPAVADRKFLEIDVDNFD
SRLKAMKPRVAFNVPNTLTGEGNLSLDITFESMDDFSPAAVARKVDALNQLLEARTQLANLLTYMDGKTG
AEEMIMKAIKDPALLQALASAPKPTDSEPQS
 
Nucleotide Sequence: 516 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2563855-2564370 Pseudomonas mendocina ymp chromosome, complete genome
ATGGCCAACCCCAGCAGCCAGAAATTCATCGCTCGCAACCGTGCTCCACGGGTGCAGATCGAGTACGACG
TGGAGCTCTACGGCGCGGAGAAGAAGGTCCAGCTGCCCTTCGTCATGGGGGTGATGGCCGATCTCGCGGG
CAAGCCCGCCGAGCCGCTGCCGGCGGTAGCTGACCGCAAGTTCCTGGAGATCGACGTGGACAACTTCGAC
TCCCGGCTCAAGGCGATGAAACCGCGCGTCGCCTTCAACGTGCCCAACACCCTCACCGGTGAAGGCAACC
TCAGCCTCGACATCACCTTCGAGAGCATGGACGACTTCAGCCCCGCCGCCGTGGCGCGCAAGGTCGATGC
CCTCAATCAACTGCTCGAAGCCCGCACCCAGCTGGCCAACCTCCTGACCTACATGGACGGCAAGACCGGT
GCCGAGGAAATGATCATGAAGGCGATCAAGGATCCGGCCCTGCTGCAGGCGCTGGCCAGTGCACCGAAAC
CGACCGATTCCGAGCCGCAGAGCTGA