SecReT6
Protein ID: 146307348
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2323
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2564386..2565882 [+]
Producthypothetical protein
NoteTssC
UniProt IDA4XUR5
KEGG IDpmy:Pmen_2323
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.70E-195, Aligned region: 67..493
BMFP [PF04380], Evalue: 0.0092, Aligned region: 21..71
Protein Sequence: 498 a.a.     [Download]
>gi|146307348|ref|YP_001187813.1| unnamed protein product [Pseudomonas mendocina ymp]
MAETMTEQQAQAGTATAEGGDFAALLLQEFKPKTERAREAVETAVRTLAEHALAKTDLISNDAIKSIESI
IAAIDAKLTEQINLIMHHQDFQQLESAWRGLSYLVNNTETDEQLKIRVMSISKGELHKTLKKFKGTAWDQ
SPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLTELSKVCAAMHAPFISAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAAWRSLRESEDARYIGLTMPRFLARLPYGAKTDPVDAFAFEEDTSGADSSKYTWA
NSAYAMAVNINRSFKLYGWCSRIRGVESGGEVTNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDLAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDD
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEIEGNPGYYSSKFFLRPHYQLEGLTVSLRLVS
KLPSAKGA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2564386-2565882 Pseudomonas mendocina ymp chromosome, complete genome
ATGGCCGAGACGATGACCGAACAGCAGGCCCAGGCCGGGACTGCTACCGCAGAAGGCGGCGACTTCGCCG
CCCTCCTCCTGCAGGAATTCAAACCCAAGACCGAGCGCGCCCGCGAGGCGGTGGAAACCGCAGTGCGCAC
CCTGGCCGAACATGCGCTGGCAAAGACCGACCTGATCTCCAACGATGCGATCAAGTCCATCGAGTCGATC
ATCGCGGCCATCGACGCCAAGCTCACCGAGCAGATCAACCTGATCATGCACCATCAGGACTTCCAGCAAC
TGGAGAGCGCCTGGCGCGGGCTGAGCTACCTGGTCAACAACACCGAGACCGACGAGCAGCTGAAGATCCG
CGTGATGAGCATCTCCAAGGGCGAGCTGCACAAGACCCTGAAGAAGTTCAAGGGCACCGCCTGGGACCAG
AGCCCGATCTTCAAGAAGATGTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTACGGCTGTCTGG
TCGGCGATTACTACTTCGACCAGTCGCCGCCGGACGTGGAACTGCTCACCGAACTGTCCAAGGTCTGCGC
GGCCATGCACGCGCCGTTCATTTCGGCGGCATCGCCCACGGTCATGGGCATGGGCTCCTGGCAGGAGCTG
TCCAACCCGCGTGACCTGACCAAGATCTTCACCACCCCCGAATACGCCGCCTGGCGCTCGCTGCGCGAGT
CCGAGGACGCCCGCTACATCGGCCTGACCATGCCGCGCTTCCTCGCCCGCCTGCCGTACGGGGCCAAGAC
CGATCCGGTCGATGCCTTTGCCTTCGAGGAAGACACCAGCGGCGCCGACAGCAGCAAGTACACCTGGGCC
AACTCGGCCTACGCCATGGCGGTGAACATCAACCGCTCGTTCAAGCTCTACGGCTGGTGCTCGCGCATCC
GCGGCGTGGAGTCCGGCGGCGAGGTGACCAACCTGCCCGCCCACACCTTCCCCACCGACGATGGTGGCGT
GGACATGAAGTGCCCCACCGAGATCGCCATTTCCGACCGCCGCGAGGCCGAGCTGGCGAAGAATGGCTTC
ATGCCCCTGCTGCACAAGAAGAACACCGACCTGGCCGCGTTCATCGGTGCGCAGTCGTTGCAGAAGCCGG
CCGAGTACGACGACCCCGACGCAACGGCCAACGCCAACCTTGCCGCGCGTCTGCCCTACCTGTTCGCCAC
CTGCCGCTTCGCGCATTACCTCAAATGCATCGTTCGCGACAAGATCGGCTCGTTCAAGGAGAAGGACGAC
ATGCAGCGCTGGCTGCAGGACTGGATCCTCAACTACGTCGATGGCGATCCCGCCCACTCCACCGAGACCA
CCAAGGCGCAGCACCCGCTGGCGGCGGCCGAGGTGGTGGTCGAGGAAATCGAAGGCAACCCCGGGTACTA
CAGCTCGAAGTTCTTCCTGCGGCCGCATTACCAGCTGGAAGGGCTCACCGTGTCGTTGCGCCTGGTGTCG
AAACTGCCCTCGGCCAAGGGCGCTTGA