SecReT6
Protein ID: 146307352
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2327
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2567442..2568227 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDA4XUR9
KEGG IDpmy:Pmen_2327
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.70E-42, Aligned region: 137..256
TPR_16 [PF13432], Evalue: 1.10E-06, Aligned region: 2..59
TPR_16 [PF13432], Evalue: 1.10E-06, Aligned region: 110..140
TPR_19 [PF14559], Evalue: 0.00011, Aligned region: 6..63
TPR_19 [PF14559], Evalue: 0.00011, Aligned region: 111..145
TPR_14 [PF13428], Evalue: 0.0022, Aligned region: 5..39
TPR_14 [PF13428], Evalue: 0.0022, Aligned region: 35..54
TPR_14 [PF13428], Evalue: 0.0022, Aligned region: 44..54
TPR_14 [PF13428], Evalue: 0.0022, Aligned region: 111..130
TPR_14 [PF13428], Evalue: 0.0022, Aligned region: 217..225
Protein Sequence: 261 a.a.     [Download]
>gi|146307352|ref|YP_001187817.1| unnamed protein product [Pseudomonas mendocina ymp]
MNADELLRAGKLDEALNALQDQVRAQPSNAALRVFLFQLLAVLGQWSRAQNQLKVAGELDASTLAMVQTY
RSALECEALRAEVFAGRLTPVLLGEPAPWLAPLIQALQVDAQGHAEAAQALRDQAFEAAPAVPGELNGEA
FAWCADADPRLGPVLELIVNGRYVWLPMENIASLTCEAPSDLRDLVWMPAELTLRNGGSTVALIPSRYPD
TVQLGDDAARLARKLDWLDNGLPIGQRLFATDLGDTALFELRSLTFGAGAA
 
Nucleotide Sequence: 786 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2567442-2568227 Pseudomonas mendocina ymp chromosome, complete genome
ATGAACGCCGATGAACTGCTACGTGCCGGCAAGCTCGATGAGGCGCTCAACGCGCTGCAGGATCAGGTGC
GGGCGCAGCCGTCCAATGCGGCGTTGCGCGTGTTCCTGTTCCAGCTGCTGGCGGTGCTCGGGCAATGGAG
CCGCGCGCAGAACCAGTTGAAGGTGGCAGGCGAGCTGGACGCGTCCACCCTGGCCATGGTGCAGACCTAC
CGTTCGGCGCTGGAATGCGAGGCGCTGCGTGCCGAAGTATTCGCCGGACGCCTGACACCGGTGCTACTGG
GCGAACCCGCGCCCTGGCTCGCGCCCCTGATCCAGGCGCTGCAAGTGGATGCGCAGGGCCATGCCGAGGC
AGCACAGGCGCTGCGCGATCAGGCCTTCGAAGCCGCACCGGCGGTACCTGGCGAACTCAATGGCGAAGCC
TTCGCCTGGTGCGCCGATGCCGACCCGCGACTCGGCCCGGTGCTGGAGCTGATCGTCAATGGCCGCTACG
TCTGGCTGCCGATGGAGAACATCGCCAGCCTGACGTGCGAGGCGCCCAGCGATCTGCGCGACCTGGTGTG
GATGCCCGCCGAGCTGACCCTGCGAAACGGCGGCAGCACCGTGGCGCTGATTCCCAGCCGTTATCCCGAC
ACCGTCCAACTCGGCGATGACGCGGCGCGCCTGGCACGCAAGCTGGACTGGCTCGACAACGGCCTGCCCA
TCGGTCAGCGGCTGTTCGCCACCGACCTGGGCGATACCGCGTTGTTCGAGCTGCGCAGCCTCACCTTCGG
CGCAGGAGCAGCCTGA