SecReT6
Protein ID: 146307353
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2328
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2568230..2568742 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA4XUS0
KEGG IDpmy:Pmen_2328
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.30E-21, Aligned region: 37..145
Protein Sequence: 170 a.a.     [Download]
>gi|146307353|ref|YP_001187818.1| unnamed protein product [Pseudomonas mendocina ymp]
MAELTLQERLQPSLLDRLTDDDPHNPKESAERRVMNQNQLKASVLRDLAWLLNTTALLDSESAAQMPAGS
SVINFGLPPLSGHTASSIDVQLVESVLTEIIETYEPRLLKGSLRVRAQLQSDEMNHNALSFEIEADLWAE
PVPLRLLLSTDLDLETGHIKVAPVDGRRRS
 
Nucleotide Sequence: 513 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2568230-2568742 Pseudomonas mendocina ymp chromosome, complete genome
ATGGCCGAGCTGACCCTGCAGGAGCGCTTGCAACCTTCGCTGCTCGATCGTCTCACCGACGACGATCCCC
ACAACCCGAAGGAAAGCGCCGAACGCCGGGTGATGAACCAGAACCAGCTCAAGGCCTCGGTGCTGCGCGA
CCTGGCCTGGCTGCTCAATACCACGGCCCTGCTCGACAGCGAGAGCGCCGCGCAGATGCCGGCCGGCAGC
TCGGTGATCAATTTCGGTCTGCCGCCGCTGTCCGGCCACACCGCTTCGAGCATCGACGTGCAGCTGGTCG
AGAGCGTGCTGACGGAAATCATCGAGACCTATGAGCCGCGTCTGCTCAAGGGCTCGCTGCGGGTGCGTGC
GCAACTGCAGAGCGACGAGATGAACCACAACGCCCTGAGCTTCGAGATCGAGGCCGACCTGTGGGCCGAG
CCGGTGCCGCTGCGCCTGCTGCTGTCCACCGATCTCGACCTGGAAACCGGGCACATCAAGGTCGCCCCGG
TCGATGGCAGGAGGCGCTCATGA