SecReT6
Protein ID: 146307355
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2330
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2570613..2571599 [+]
Producthypothetical protein
NoteTssG
UniProt IDA4XUS2
KEGG IDpmy:Pmen_2330
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.20E-112, Aligned region: 3..300
Protein Sequence: 328 a.a.     [Download]
>gi|146307355|ref|YP_001187820.1| unnamed protein product [Pseudomonas mendocina ymp]
MVDAPWSYDFFQALRRIECEAADRPRLGHSVRLADDPLRLGQQPECGFAPSTLASVQPGQVPRIEQFFFG
LTGPNGPLPLHLTEYARERQRNAGDPTFKRFLDVFHHRLLTLFYRAWAESRPTVSHDRPDDDYWSMRLAA
LSGRGMTSLLGQGPLADSASLHYSGHLAAQTRYPDGLRAILEHYFEVPVSIEEYVGQWLQLPHYSQVGAA
ACTLGSDLCLGSHVWDRQHKFRIRLGPLSLEQYQRLLPGQENFAELAAWVAEHQGDELDWEVNLVLHCQE
TPRIDLDGRTQLGFNTWLGTPLQDPDDLLLVRDYASRQTTESRSCEHE
 
Nucleotide Sequence: 987 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2570613-2571599 Pseudomonas mendocina ymp chromosome, complete genome
ATGGTCGACGCACCCTGGAGCTACGATTTCTTCCAGGCGCTGCGGCGTATCGAGTGCGAGGCGGCCGACC
GGCCGCGCCTCGGCCATTCGGTGCGCCTGGCCGACGATCCGCTGCGCCTCGGCCAGCAGCCCGAATGCGG
TTTTGCCCCCTCGACCCTGGCCAGCGTGCAACCGGGCCAGGTGCCGCGCATCGAACAATTCTTCTTCGGT
CTGACCGGCCCCAACGGCCCGCTGCCCCTGCATCTGACCGAATACGCCCGCGAGCGCCAGCGCAACGCCG
GCGACCCCACCTTCAAGCGCTTCCTCGACGTCTTTCATCATCGCCTGCTCACCCTGTTCTATCGCGCCTG
GGCCGAATCCCGCCCGACCGTCAGCCATGACCGGCCGGATGACGACTACTGGTCGATGCGCCTGGCGGCG
CTATCCGGACGCGGCATGACCAGCCTGCTCGGCCAGGGCCCGCTGGCCGATTCGGCGAGCCTGCACTACA
GCGGCCACCTGGCGGCGCAGACCCGCTACCCGGATGGACTGCGCGCCATTCTCGAACACTATTTCGAGGT
GCCGGTGAGCATCGAGGAATACGTCGGCCAATGGCTGCAGCTGCCGCATTACAGCCAGGTCGGCGCGGCC
GCCTGCACGCTGGGTAGCGACCTGTGCCTGGGTTCCCACGTGTGGGATCGCCAACACAAGTTCCGTATCC
GCCTCGGCCCACTGAGCCTCGAGCAATACCAGCGCCTGCTGCCGGGGCAGGAGAACTTCGCCGAGCTGGC
GGCCTGGGTCGCCGAACATCAGGGCGACGAACTGGATTGGGAGGTGAACCTGGTGCTGCATTGCCAGGAG
ACGCCGCGCATCGATCTCGACGGCCGCACCCAGCTCGGCTTCAACACTTGGCTCGGCACACCGCTACAGG
ACCCCGACGACCTGCTGCTGGTGCGCGACTACGCCAGCCGGCAAACCACCGAATCAAGGAGCTGCGAACA
TGAGTGA