SecReT6
Protein ID: 146307356
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2331
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2571592..2574294 [+]
ProductATPase
NoteTssH
UniProt IDA4XUS3
KEGG IDpmy:Pmen_2331
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.10E-39, Aligned region: 631..797
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 234..367
AAA [PF00004], Evalue: 3.80E-19, Aligned region: 637..721
ClpB_D2-small [PF10431], Evalue: 1.60E-14, Aligned region: 804..878
AAA_16 [PF13191], Evalue: 6.10E-13, Aligned region: 211..251
AAA_16 [PF13191], Evalue: 6.10E-13, Aligned region: 278..313
AAA_16 [PF13191], Evalue: 6.10E-13, Aligned region: 498..528
AAA_16 [PF13191], Evalue: 6.10E-13, Aligned region: 625..681
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 234..253
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 352..364
AAA_5 [PF07728], Evalue: 1.60E-12, Aligned region: 636..752
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 344..405
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 634..657
AAA_22 [PF13401], Evalue: 1.70E-07, Aligned region: 698..718
Sigma54_activat [PF00158], Evalue: 9.00E-07, Aligned region: 213..248
Sigma54_activat [PF00158], Evalue: 9.00E-07, Aligned region: 635..754
AAA_25 [PF13481], Evalue: 8.00E-06, Aligned region: 229..311
AAA_25 [PF13481], Evalue: 8.00E-06, Aligned region: 483..513
AAA_25 [PF13481], Evalue: 8.00E-06, Aligned region: 634..661
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 234..250
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 635..676
Arch_ATPase [PF01637], Evalue: 5.30E-05, Aligned region: 212..250
Arch_ATPase [PF01637], Evalue: 5.30E-05, Aligned region: 285..383
Arch_ATPase [PF01637], Evalue: 5.30E-05, Aligned region: 635..657
Arch_ATPase [PF01637], Evalue: 5.30E-05, Aligned region: 703..718
IstB_IS21 [PF01695], Evalue: 0.00034, Aligned region: 217..255
IstB_IS21 [PF01695], Evalue: 0.00034, Aligned region: 636..664
AAA_19 [PF13245], Evalue: 0.00042, Aligned region: 234..255
AAA_19 [PF13245], Evalue: 0.00042, Aligned region: 634..658
NACHT [PF05729], Evalue: 0.00043, Aligned region: 234..331
NACHT [PF05729], Evalue: 0.00043, Aligned region: 636..663
AAA_29 [PF13555], Evalue: 0.00061, Aligned region: 226..250
AAA_29 [PF13555], Evalue: 0.00061, Aligned region: 634..661
AAA_18 [PF13238], Evalue: 0.0007, Aligned region: 234..251
AAA_18 [PF13238], Evalue: 0.0007, Aligned region: 637..661
TSC22 [PF01166], Evalue: 0.00073, Aligned region: 437..464
TSC22 [PF01166], Evalue: 0.00073, Aligned region: 536..561
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 234..250
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 636..671
Clp_N [PF02861], Evalue: 0.0039, Aligned region: 29..75
Clp_N [PF02861], Evalue: 0.0039, Aligned region: 108..133
Protein Sequence: 900 a.a.     [Download]
>gi|146307356|ref|YP_001187821.1| unnamed protein product [Pseudomonas mendocina ymp]
MSEISRAALFGKLNSLAYKAIEAATVFCKLRGNPYVELVHWLHQILQLQDSDLHQLVRQFNIDPARLAKD
ITEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTAYLIVGILKTPSLRHALSAISREFDK
IKVESLIERFDEYVGNSPENGLGASDGFNAAGAPGEASGAMAPSAMGKQEALKRFTVDLTEQARSGKLDP
IVGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPSLKDVELRALDVGLLQAGA
SMKGEFEQRLRQVIEDVQSSPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEY
KKHIEKDPALTRRFQVVQVDEPSEHKAILMMRGVASTMEQHHKVQILDEALEAAVKLSHRYIPARQLPDK
SVSLLDTACARVAISLHAVPAEVDDSRRRIEALETELAIIAREQAIGIAIGSRQDDTQAALDEERTRLGE
LEARWAEEKTLVDELLATRASLRAAAEPVDGTSREGGADTPALSQEELDTLRTRLSELQNSLNALQGENP
LILPTVDYQAVASVVADWTGIPVGRMARNEIDTVLRLDEHLKKRIIGQDHALAMIAKRIQTSRAGLDNPS
KPIGVFLLAGTSGVGKTETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEA
VRRKPYSVVLLDEVEKAHPDVHEIFFQVFDKGVMEDGEGRLIDFKNTLILLTTNAGTDMIASLCSDPELM
PDPDSIAKALREPLLKVFPPALLGRLVTIPYYPLSDTMLKAITRLQLDRIKKRVEAGHKVPFEYDDSVID
LIVSRCTEIESGGRMIDAILTNSLLPDMSREFLTRMLEGKPLAGVRISQRDNALHYDFGA
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2571592-2574294 Pseudomonas mendocina ymp chromosome, complete genome
ATGAGTGAGATCAGCCGCGCCGCATTGTTCGGCAAGTTGAACAGCCTGGCCTACAAGGCCATCGAAGCCG
CCACGGTATTCTGCAAGCTGCGCGGCAATCCCTATGTCGAGCTGGTGCACTGGCTGCATCAGATTCTCCA
GCTGCAGGATTCCGACCTGCACCAGCTGGTGCGCCAGTTCAACATCGACCCGGCGCGACTGGCCAAGGAC
ATCACCGAGGCGCTGGATCGCCTGCCGCGCGGTTCCACCTCGATCACCGACCTGTCGTCCCACGTCGAAG
AGGCGGTCGAGCGTGGCTGGGTCTACGGCAGCCTGATGTTCGGCGAAAGCCAGGTGCGCACCGCCTACCT
GATCGTCGGCATCCTCAAGACACCGAGCCTGCGCCATGCGCTGTCGGCCATTTCCCGCGAGTTCGACAAG
ATCAAGGTGGAAAGCCTGATCGAGCGCTTTGACGAGTATGTCGGCAACTCGCCGGAGAACGGCCTCGGTG
CCAGCGACGGATTCAACGCCGCCGGGGCGCCGGGCGAAGCCAGCGGCGCCATGGCCCCCAGTGCCATGGG
CAAGCAGGAGGCGCTCAAGCGCTTCACCGTCGACCTCACCGAACAGGCGCGCAGCGGCAAGCTCGACCCC
ATAGTCGGGCGCGACGAGGAGATTCGTCAGTTGGTGGACATCCTCATGCGCCGCCGGCAGAACAACCCGA
TCCTCACTGGCGAGGCCGGCGTCGGCAAGACCGCGGTGGTCGAGGGCTTTGCCCTGCGCATCGTCGCCGG
CGACGTGCCGCCGAGCCTCAAGGATGTCGAACTGCGCGCGCTCGACGTCGGCCTGCTGCAGGCTGGCGCA
AGCATGAAAGGCGAATTCGAGCAGCGCCTGCGCCAGGTGATCGAGGACGTGCAGAGCTCGCCCAAGCCGA
TCATCCTGTTCATCGACGAGGCGCATACCCTGGTCGGCGCCGGTGGCGCGGCCGGCACCGGCGACGCCGC
CAACCTGCTCAAGCCAGCACTGGCGCGCGGCACCCTGCGCACCGTGGCCGCCACCACCTGGGCCGAGTAC
AAGAAGCACATCGAGAAGGACCCGGCGCTGACCCGGCGCTTTCAGGTGGTGCAGGTGGACGAGCCGTCCG
AGCACAAGGCGATCCTGATGATGCGCGGCGTGGCCTCGACCATGGAGCAGCACCACAAGGTGCAGATCCT
CGACGAGGCGCTGGAGGCCGCGGTCAAGCTGTCGCACCGCTACATCCCGGCGCGCCAGTTGCCGGATAAA
TCGGTGAGCCTGCTCGACACCGCCTGCGCCCGCGTCGCCATCAGCCTGCATGCGGTGCCGGCCGAGGTGG
ACGACAGCCGCCGGCGTATCGAGGCACTGGAGACCGAGCTGGCCATCATCGCCCGCGAGCAGGCCATCGG
CATCGCCATCGGCAGTCGCCAGGACGACACGCAGGCCGCTCTGGATGAGGAGCGCACCCGCCTGGGCGAG
CTGGAAGCGCGCTGGGCCGAGGAAAAGACCCTGGTCGACGAGCTGCTGGCCACCCGCGCCAGCCTGCGCG
CCGCCGCCGAGCCGGTGGACGGCACCAGCCGCGAAGGTGGCGCCGACACCCCTGCCCTGAGCCAGGAGGA
ACTGGACACCCTGCGCACCCGTCTCAGCGAACTGCAGAACAGTCTGAACGCTCTGCAAGGGGAAAATCCG
CTGATCCTGCCCACGGTCGATTATCAGGCCGTGGCCTCGGTGGTGGCCGACTGGACCGGCATTCCGGTCG
GGCGCATGGCGCGTAACGAGATCGATACCGTGCTGCGTCTCGACGAGCACCTGAAAAAACGCATCATCGG
TCAGGACCACGCCCTGGCGATGATCGCCAAGCGCATCCAGACCTCACGCGCCGGGCTGGACAACCCGAGC
AAGCCGATCGGCGTGTTCCTCCTCGCCGGCACCTCCGGGGTGGGCAAGACCGAGACCGCGCTGGCCCTGG
CCGAGGCCATGTACGGCGGCGAGCAGAACGTCATCACCATCAACATGAGCGAATTCCAGGAGGCGCACAC
CGTCTCCACCCTCAAGGGCGCCCCGCCCGGCTACGTCGGCTACGGCGAAGGCGGCGTGCTGACCGAGGCC
GTCAGGCGCAAGCCCTACAGCGTGGTGCTGCTGGATGAGGTGGAGAAGGCGCATCCGGACGTGCACGAGA
TCTTCTTCCAGGTCTTCGACAAGGGCGTGATGGAAGATGGCGAGGGTCGCCTGATCGACTTCAAGAACAC
CCTGATTCTGCTCACCACCAACGCCGGCACCGACATGATCGCCAGTCTGTGCAGCGACCCGGAGCTGATG
CCCGATCCGGACTCCATCGCCAAGGCCCTGCGCGAGCCGCTGCTCAAGGTATTCCCGCCGGCGCTGCTCG
GCCGTCTGGTGACCATCCCCTACTACCCGCTCTCCGACACCATGCTCAAGGCCATCACCCGGCTGCAGCT
CGACCGCATCAAGAAGCGCGTGGAAGCCGGCCACAAGGTGCCATTCGAGTACGACGACAGCGTGATCGAC
CTGATCGTCTCGCGCTGCACCGAGATCGAGAGCGGCGGCAGGATGATCGACGCCATTCTGACCAACAGCC
TGTTGCCGGACATGAGTCGTGAGTTCCTCACCCGCATGCTCGAGGGCAAACCGCTCGCCGGCGTGCGCAT
CAGCCAACGCGACAACGCCCTGCACTACGACTTCGGCGCCTAA