SecReT6
Protein ID: 146307357
SecReT6 ID207
T6SS typei3
Gene symbol-
Locus tagPmen_2332
StrainPseudomonas mendocina ymp
Repliconchromosome [GenBank: NC_009439] [Browse all T6SS(s) in this replicon]
Location [Strand]2574325..2576550 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA4XUS4
KEGG IDpmy:Pmen_2332
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-85, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 3.10E-25, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 514..533
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 530..552
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 594..616
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 601..624
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 610..632
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 617..640
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 626..648
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 642..664
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 692..710
Gp5_C [PF06715], Evalue: 3.10E-24, Aligned region: 715..726
DUF2345 [PF10106], Evalue: 0.0035, Aligned region: 625..659
DUF2345 [PF10106], Evalue: 0.0035, Aligned region: 665..699
DUF2345 [PF10106], Evalue: 0.0035, Aligned region: 686..732
Protein Sequence: 741 a.a.     [Download]
>gi|146307357|ref|YP_001187822.1| unnamed protein product [Pseudomonas mendocina ymp]
MAITQSTRAVQVNGPLGPNVLLLQGMDGSEELGRPFQYHLELTSEDGSVKFDQLLGKPMGLSLELPDGGD
RYFHGIVCACRQTVGIGQFAGYQVTLRPWLWLLSRTSDCRIFQNKTVPDIIKQVFRDLGFSDFEDSLSRS
YREWEYCVQYRETSFDFVSRLMEQEGIYYYFRHEKARHVLVLADAYGAHSTVDGYASVPFYPPELQMRER
DHFYDWQLAREVQPGSLALTDYDFQRPSASLDVRSSVSRSHGNAEYPLFDYPGEYVQSKDGEHYARTRIE
AIHTQFERVQLRGRARGLGSGHLFKLSGYERADQNREYLVVGARYRIRQEAYETGFGDNLEQFTSELDCM
DASQAFRPLPLTPMPIVRGPQTAMVVGPSGEEIWTDQYGRVKVHFYWDRHDQSDENSSCWMRVSQAWAGK
NWGAIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGVKSRSSKEGTPANFNEIRM
EDKKGEEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDNDETVHVKHDRTETVDNNETITIGVDRTEKVG
NNETITIGVDRTEKVGSNEKISIGNNRTEDVGSDESITIGANRTEKVGSNEKISIGNNRTEDVGSDESIT
IGSNRTEKVGKNEDISIGSNQSTSIGKNESRSVGQSRDSSIGKDDSLSVGKNFSLNAGDSITLTTGSASI
TMKKDGTITIRGKNITIDGSGAINVKASKNVVVKGQKILQN
 
Nucleotide Sequence: 2226 bp     [Download]
>gi|146305042|ref|NC_009439.1|:2574325-2576550 Pseudomonas mendocina ymp chromosome, complete genome
ATGGCCATCACGCAAAGCACAAGAGCGGTTCAGGTCAACGGACCACTGGGGCCCAACGTCCTGCTGTTGC
AGGGCATGGATGGCAGCGAAGAACTGGGCCGCCCGTTCCAGTACCACCTGGAGCTGACCTCGGAAGATGG
CTCGGTGAAGTTCGACCAGCTGCTGGGCAAGCCCATGGGGCTGTCGCTGGAGCTGCCCGATGGCGGCGAT
CGTTACTTCCACGGCATCGTCTGCGCCTGCCGACAGACCGTGGGCATCGGCCAGTTCGCCGGCTATCAGG
TCACCCTGCGACCATGGCTGTGGCTGCTGAGCCGGACCTCCGACTGCCGCATCTTCCAGAACAAGACGGT
GCCGGACATCATCAAGCAGGTGTTCCGCGACCTGGGTTTTTCCGATTTCGAAGACAGCCTCAGCCGCAGC
TACCGGGAGTGGGAGTACTGCGTGCAGTACCGGGAAACCAGCTTCGATTTCGTCAGCCGGCTGATGGAAC
AGGAAGGCATCTACTACTACTTCCGCCACGAGAAGGCGCGCCACGTGTTGGTGCTGGCCGACGCCTACGG
CGCCCATTCGACGGTGGACGGCTACGCCAGCGTGCCGTTCTACCCGCCCGAACTGCAGATGCGCGAGCGC
GACCACTTCTACGACTGGCAGCTGGCGCGCGAGGTGCAGCCCGGCTCCCTGGCGCTGACCGATTACGACT
TCCAGCGCCCCAGCGCCAGCCTCGACGTGCGTTCCAGCGTCTCGCGCAGCCATGGCAACGCCGAATACCC
GCTGTTCGACTATCCCGGCGAGTATGTGCAAAGCAAGGACGGCGAGCACTACGCACGCACCCGCATCGAG
GCCATCCATACGCAGTTCGAGCGCGTGCAGCTGCGCGGCCGTGCCCGCGGCCTGGGCTCGGGCCATCTGT
TCAAGCTCAGCGGTTACGAGCGCGCCGACCAGAACCGCGAGTACCTGGTGGTCGGTGCGCGCTACCGCAT
CCGCCAGGAGGCCTATGAGACCGGCTTCGGCGACAACCTCGAGCAGTTCACCAGCGAGCTGGACTGCATG
GACGCCAGCCAGGCCTTTCGCCCCCTGCCGCTGACCCCCATGCCCATCGTGCGCGGGCCGCAGACCGCCA
TGGTGGTCGGCCCCAGCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGGTCAAGGTGCACTTCTACTG
GGACCGCCACGACCAGTCCGACGAGAACAGCTCCTGCTGGATGCGCGTGTCGCAGGCCTGGGCCGGCAAG
AACTGGGGCGCGATCCAGATTCCGCGCATCGGCCAGGAGGTGATCGTCAGCTTCCTCGAAGGCGATCCGG
ATCGGCCGATCATCACCGGTCGCGTTTACAACGCCGAGCAGACGGTGCCCTACGACCTGCCCGCCAACGC
CACCCAGAGCGGCGTGAAGAGCCGTTCGAGCAAGGAAGGCACGCCGGCTAACTTCAACGAGATCCGCATG
GAGGACAAGAAAGGCGAGGAGCAGCTGTTCATCCATGCGGAAAAGAACCAGGACATCGAGGTCGAGAACG
ACGAGACCCACTGGGTCGGCCACGACCGCACCAAGACCATCGACAACGACGAAACGGTGCACGTCAAACA
CGACCGTACCGAGACGGTGGACAACAACGAAACCATCACCATCGGTGTGGACCGCACGGAGAAGGTCGGC
AACAACGAGACCATCACCATCGGCGTCGATCGCACCGAAAAAGTCGGCAGCAACGAGAAGATCAGCATCG
GCAACAACCGCACCGAGGATGTCGGCAGCGACGAGAGCATCACCATCGGCGCCAACCGCACCGAGAAGGT
CGGCAGCAACGAGAAGATCAGCATCGGCAACAACCGCACCGAGGACGTCGGCAGCGACGAGAGCATCACC
ATCGGCAGCAACCGTACCGAGAAGGTCGGCAAGAACGAAGACATCAGCATCGGCAGCAACCAGAGCACCA
GCATCGGCAAGAACGAGTCGCGCAGCGTCGGTCAGAGTCGCGACAGCAGCATCGGCAAGGACGACAGCCT
GAGCGTGGGCAAGAACTTCTCCCTGAACGCGGGCGACTCCATCACCCTGACCACCGGCTCGGCCAGCATC
ACCATGAAGAAGGACGGCACCATCACCATTCGCGGCAAGAACATCACCATCGACGGCTCCGGGGCGATCA
ACGTCAAGGCGAGCAAGAACGTGGTGGTCAAGGGGCAGAAGATTCTGCAGAACTAG