SecReT6
Protein ID: 147671421
SecReT6 ID208
T6SS typei1
Gene symbolvgrG-3
Locus tagVC0395_0014
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]12071..15124 [-]
ProductvgrG protein
NoteTssI
UniProt IDA5F1C4
KEGG IDvco:VC0395_0014, vcr:VC395_A0116
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.30E-60, Aligned region: 42..335
Phage_base_V [PF04717], Evalue: 7.40E-25, Aligned region: 374..467
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 536..549
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 731..773
PG_binding_1 [PF01471], Evalue: 6.70E-09, Aligned region: 787..799
DUF2345 [PF10106], Evalue: 5.30E-05, Aligned region: 570..619
PG_binding_3 [PF09374], Evalue: 0.00085, Aligned region: 734..767
PG_binding_3 [PF09374], Evalue: 0.00085, Aligned region: 785..802
Protein Sequence: 1017 a.a.     [Download]
>gi|147671421|ref|YP_001214855.1| vgrG protein [Vibrio cholerae O395]
MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTIL
RDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYA
FALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGG
EINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFS
QIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYS
NQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNEL
SFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHE
VGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGS
GSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPE
RILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQK
SYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGN
GDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFREEQHQFIKRIH
YDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNMESMTDKDIIILVQDYKLVNTE
RLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK
 
Nucleotide Sequence: 3054 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c15124-12071 Vibrio cholerae O395 chromosome 1, complete sequence
ATGGCAAGGTTACAGTTTCAATTAAAGGTGGATGGCCTTGAGGATGAATCCCTCGTCGTACGCGGATTTG
AAGGGCAAGAGTCCTTGTCTGATTCTGTATGGCGCTGTGAACCCTGCTATGGTTTTCGCTATCAGGTTGA
TTTAGCCAGTGCGCTAAGCAACCTTACTGCTGAGCAATTTGTCGACCAAACCGCGCATTTAACCATTCTG
CGTGACGGGCAAGTGGTGCAGCAAATTAACGGTATCGTACGCCAATTGAGTAAAGGCGATACTGGGCATC
GGCACACGTTTTATTCTCTTACGTTAGTACCTGCGCTGGAGCGGCTTTCTTTACGCAGTAATAGCCGTAT
TTTCCAGCAGCAAAGCGTGCCGGAAATTATCTCTATTTTACTGCAAGAGATGGGGATTGAAGATTACGCC
TTTGCCCTTAAGCGTGAGTGTGCCCAGCGTGAGTTTTGTGTGCAGTACCGTGAAACGGATTTGCAGTTTT
TACACCGTATCGCCGCCGAAGAAGGCTTGGTATACAGTCACCTACATGAAGCGCAGAAACACACGCTACT
GTTTACCGATAGCTCGGACAGCCAACCGAAGTTAGCCAAGCCAGTACCTTATAATGCGCTGGCGGGTGGC
GAGATCAATCTCCCTTATGTGGTCGATCTGCAATTCAAGACCACCGCACAAGTCAGCCATACCGAGCTAA
AGGATTACAGCTTTAAAAAGCCAGCTTACGGATTTACTCAGCGCACGCAGGGTAAAGATATCGCTTATCA
GCAGCCAAATTATGAGCATTTTGATGCTCCGGGACGCTACAAAGACGATGCAAATGGCAAGGCCTTTAGC
CAAATTCGCTTAGAGTATTTACGTCGCGATGCTTTGCTTGCTGATGCGAAGAGTGACGAACCTTTGCTGT
TGGCGGGAGTGCGTTTTGACTTGCAAGATCACCTTGATCACGCAATGAATCGAGATTGGCTCGTGGTACA
AGCCAATCACCAAGGGACGCAGCCACAAGCGTTACAAGAAGAGGGTGGTTCAGGCGCTACCACTTACAGC
AATCAGCTAAAACTTATTCCCGCTCACATCACTTGGCGAGCAAGGCCTTGTGCTAAGCCGCAAGTGGATG
GTCCCATGATCGCCACCGTGGTTGGGCCACAAGGTGAAGAGATTTATTGCGATAACTTTGGTCGCGTGAA
AGTGCATTTCCCGTGGGATCGCTACTCAAGTAGCAACGAAAAAAGCTCTTGCTGGGTGCGAGTGGCACAA
GAATGGGCTGGTAGCCAATACGGTAGTATGGCGATTCCGCGAGTTGGCCATGAAGTGATTGTTTCGTTCC
TGAATGGCGATCCGGATCAACCCATCATCACAGGTCGTACGTATCATGCGACCAATACCGCGCCTTACGC
CTTGCCTGACCACAAAACCAAAACCGTGCTGCGCACTGAGACTCACCAAGGGCAAGGCTACAACGAACTG
AGTTTTGAGGATCAAGCGGGCAGCGAACAGATTTTGCTGCATGCACAAAAAGATTGGGATGCGTTGATTG
AGCATGATCACACCGAAGTGATTCGCCACGATCAACATCTCACTGTGGACAATGATCGCTTTACCCGCAT
TCAGCGCAACCAACATTTAACGGTTGAAGGTGAAGTCCGTAGCAAAATCGCACTCGATAGCAGCCATGAA
GTCGGCGCGTCACTACAACACAAAGTCGGGCAGCGCATTGCTGTCGAGGCGGGTAAAGAGATTTCACTCA
AAAGCGGCGCAAAAATCGTGGTTGAAGCCGGAGCGGAGTTAACCCTAAAAGCTGGGGGCAGTTTTGTAAA
AGTCGATGCTGGTGGCGTGCACTTAGTCGGTCCTGCCATTAACCTAAACGCGGGCGGCAGTGCAGGCAGC
GGTAGCGCTTATGGCGGGCAATTAGCGGCAGCACCGAGAATGTTAGCGCAAGCTAAACCAGTAGCAGAAT
TGGTTCAGCCGGATATTGCGGCCTCAATGCAATCAGGCGCGGCGCGTGTTATTGATGTGGCATCACTCCC
CACAATGATGCCGAGTTCAGCCAATAACACGGCAAATGATGAGCCTGTGGCCGAAGAGAAAACACCGGAG
CGAATTTTAAAATCCGATCTCCTCAAACCATCCGATGAGTTAGAGAAACTCGCCAAGCGACAAGCGAGTG
CTTATCGTCAAGGTAATCACAGCGATGAGGTTAAGTTACTACAAGAAGCGCTCATAAAATTGGGGTTTGA
TCTCGGGAAAGCAGGAGCTGATGGTGACTTTGGGAGCAAAACTAAAACCGCGATTGAGCAGTTCCAGAAA
AGCTATCAACCAAGCCACCAAACCCACCCGTCTTACAGCATTGGCGCTGTTGACGGTATTGTCGGCAAAG
GTACACTACTGGCACTAGACGAAGCCTTGATGGATGGGTGGGTGTATGAGAATAATATTTATCAAATATG
GCCTCTAGGTAAAACGTCAGAGAAATATGAGTCGGCAGGAAGAGGCCCAGGGGTTATATCAACAGGAAAT
GGAGATTATGGTGGGGCTTCATATGGTTGCTATCAAATGTCATCAAATCTTGGTGTGGTACAAAAATATA
TTCAGTCATCAAAATTCAAAGAATTCTTTAGTGGATTAAATCCCGCTACGAAAGAGTTTAATGTTGTTTG
GCAGGATATAGCTTCAAGATATCCTCAGGAATTCAGAGAAGAACAACACCAATTTATTAAGAGAATTCAT
TATGATATACAAATAGGACATCTTAGAGGGAAAGGACTTTTGTTTGAACATAATCGAGCTGCTGTACATG
ATTTGATCTGGTCTACTTCAGTACAGTTTGGTGGGAGAACTAATTTGATTTTCAATGCATTGAATGGACA
AAATATGGAAAGTATGACTGATAAGGACATCATTATTCTGGTACAAGATTACAAGCTTGTTAATACAGAA
AGGCTTTTTAAGTCTTCGCCATCATGGTGGAGTGATTTAAAAAAACGTGCGGTATCAGAGAAAAAAGCTT
TACTTGAACTAGAAATTGACGGTTTGGAGGTTGATATAAAATGA