SecReT6
Protein ID: 147671491
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0025
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]28664..29140 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDA5F1D5
KEGG IDvcr:VC395_A0106, vco:VC0395_0025
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 12..148
Protein Sequence: 158 a.a.     [Download]
>gi|147671491|ref|YP_001214866.1| putative lipoprotein [Vibrio cholerae O395]
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFELKDDSMFMSSD
YDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHFAEPELSEWKKAVKVINKGRE
YHLLMLFKDYDVKLDRVE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c29140-28664 Vibrio cholerae O395 chromosome 1, complete sequence
GTGAACAAAGTGCTGTGGATGCTGTTTGCCTTGACGGTGCTGACCGCGTGCAGTTCGTCGGATAAGTACG
AGCCTGCGAAAGAGCCGACCAAGGTGACTTTTAGCTTAGTCAGCGATGAAGGGGTGAACCCGAACATCTG
GGGTGAAGCGTCACCGATAGAAATTCAAGTTTTTGAGCTAAAGGATGACTCGATGTTTATGTCGTCCGAC
TACGACCAGATCAAAACCGATTATAAAAAAGCGCTGCGCAGTAACTTTGTTAAAAACTACGACTATGTAC
TGACTCCAGGGCAGTTCAAATTCGTCAACGCTTTCGAAGTCGATGAGGAGACCAACTACATCGGCGTGAT
GGCTCATTTTGCCGAGCCTGAACTCAGCGAATGGAAGAAAGCGGTCAAGGTGATCAATAAAGGGCGAGAG
TATCACTTGCTGATGCTGTTTAAAGACTACGATGTGAAATTGGATAGGGTGGAATAA