SecReT6
Protein ID: 147671686
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0027
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]30633..31586 [-]
Producthypothetical protein
NoteTssG
UniProt IDA5F1D7
KEGG IDvco:VC0395_0027
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.50E-93, Aligned region: 6..304
Protein Sequence: 317 a.a.     [Download]
>gi|147671686|ref|YP_001214868.1| hypothetical protein VC0395_0027 [Vibrio cholerae O395]
MSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLVFSANPSLGFSPSDVMALEARDDDRWVMLTNF
FGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKYRYYVRFQPGAQDVFSAQLFAL
VGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDVSIRQWVRRRVSIDRSQQLALG
KQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLCKLVEFILREQMAYDLELAMDE
REAPLFCLDAKQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 954 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c31586-30633 Vibrio cholerae O395 chromosome 1, complete sequence
TTGAGCTTGCCGGGCAATGTACGGGAATACAACTTCTACCAACTGGTTGAGCTGTTGCAAAAACTGGCTG
ATATCAATCCTGAATCGGAAGAGTGGGAGCGCGATTGCCGCTTGGTGTTCAGTGCTAACCCGAGCCTTGG
ATTTTCGCCTAGTGATGTGATGGCGCTTGAAGCGCGTGACGATGATCGCTGGGTTATGTTGACCAACTTT
TTTGGCCTTTCCGGTGCACAGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTG
GGGGGTATAAGCAGCCGTTTCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCG
TAAATACCGTTACTACGTACGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTG
GTGGGGTTGGGCGATCCTGACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGG
GCACGCTGGCCGGACGTAGCCGTTCGCCACAAGTCGTGGCCGGCATTATTGCTCACTGTTTTGATTTACC
GGATGTCTCCATTCGCCAGTGGGTCAGACGTCGGGTATCGATTGACCGGAGTCAGCAACTGGCGCTGGGC
AAGCAGAATGCGCGGTTGGGGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGTAGTGGAAAATTTA
TTATCTGTATCAAACGGTTATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCC
ACTTTGCAAGCTGGTGGAGTTTATTTTGCGCGAACAGATGGCGTACGACCTCGAGCTGGCGATGGATGAA
CGGGAAGCGCCGCTGTTTTGTCTGGATGCGAAACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCC
AAGATGCAGCCAATAAACATGTGTTAATTCAAGTAAGGCAATAA