SecReT6
Protein ID: 147671772
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0022
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]26545..27318 [-]
Producthypothetical protein
NoteTssL
UniProt IDA5F1D2
KEGG IDvcr:VC395_A0108, vco:VC0395_0022
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-69, Aligned region: 37..242
Protein Sequence: 257 a.a.     [Download]
>gi|147671772|ref|YP_001214863.1| hypothetical protein VC0395_0022 [Vibrio cholerae O395]
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTI
EEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRA
KYTLSRQMPVWSVFAGFIVLWVGLFLGYSYVLHSKSSDVLNQLNQIL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c27318-26545 Vibrio cholerae O395 chromosome 1, complete sequence
ATGTCACAGAGTAAAAAAGAGACGCCATTAGCCAGTTTGTTGTTCGACGATGTGGAAAAAATTAACCACG
ACCAAGACTACTGGTTCCAATTGCGTGGGGACAATCCGAATGTGCTGATTGATGCCGCGACACCCTTGTT
TGGGCTTTCTCTGCGGGTTCGTACCCTCACCGAATGCGACAACATTGAACAGATCTACCGTCAGACGATT
GAAGAGATCAAAGCGATTGAAATTGAGTTGACGGAGCAAGGTTACGAACACGCCATTTTGATGGCCTATC
GCTACATCTTGTGCGCCTTTTTGGATGAATCCGTGATGGGAACCGAGTGGGGCGCGTCCAGTTTATGGGC
CGAGCACTCCATGCTGTCACGCTTCCATAATGAAACGTGGGGTGGCGAGAAAGTGTTTACGATTTTGAGC
CGTCTTGAGGGTGAACCACACCGTTACCAAGCGCTATTGGCCTTTATTTATCATTGCCTGATTTTGGGCT
TTGAAGGCAAATACCGTGTGATGGAAGGGGGACAAGCTGAGCGCGAAAAAGTGATCAGCCGCCTGCATCA
ACTGCTGAGCAGCTTGGAAGAGAGCGAGCCACAAGACTTAACCCGTCCGACCGATCATGTGGTGCGTGCG
AAATATACCCTAAGCAGACAGATGCCTGTTTGGTCTGTGTTTGCTGGCTTTATCGTGCTTTGGGTAGGTC
TATTTCTCGGCTACAGCTATGTACTGCATAGCAAATCCAGCGATGTGCTCAATCAACTCAATCAAATACT
TTAA