SecReT6
Protein ID: 147671784
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0019
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]21662..22345 [-]
Producthypothetical protein
NoteVCA0118
UniProt IDA5F1C9
KEGG IDvcr:VC395_A0111, vco:VC0395_0019
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 2.40E-58, Aligned region: 41..221
Protein Sequence: 227 a.a.     [Download]
>gi|147671784|ref|YP_001214860.1| hypothetical protein VC0395_0019 [Vibrio cholerae O395]
MPEIGDQNPMRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQV
AIAPSNPYPAEWQRAMVALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSR
IELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFD
TRGVNEALDALRERCGW
 
Nucleotide Sequence: 684 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c22345-21662 Vibrio cholerae O395 chromosome 1, complete sequence
GTGCCTGAAATTGGAGATCAAAACCCCATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGGTTGCG
CGGGCTCTGCGCATGTTTTAGCAGCATCGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCG
CGAAATTCCTGCGCGTTTAGAGCGTTTGGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTG
GCTATCGCACCGTCCAATCCTTATCCCGCAGAGTGGCAACGCGCCATGGTGGCATTGTCTGAGTCGCAGT
CCGAAGCGGGTTGGGTATTAGGTACGCAAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGC
GCAAAATCGCAGCTCAGGGGAAACATCTCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGC
ATTGAGCTGGCTTTACCGAAAGAAGTGGCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGT
TCTGGCGCAGTGACGATCACGGCGTACTGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAA
ATTGGCCGCCAGTGAGTCTCGCCTGTTGCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGAT
ACTCGAGGTGTCAATGAAGCCCTTGATGCTTTGCGCGAACGCTGTGGTTGGTAA