SecReT6
Protein ID: 147671801
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0029
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]33388..33813 [-]
Producthypothetical protein
NoteTssE
UniProt IDA5F1D9
KEGG IDvcr:VC395_A0102, vco:VC0395_0029
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-16, Aligned region: 37..123
Protein Sequence: 141 a.a.     [Download]
>gi|147671801|ref|YP_001214870.1| hypothetical protein VC0395_0029 [Vibrio cholerae O395]
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAPHLGLVDFNDA
TLETLDLSVRIKLAIQQCLERYEPRLTRADQDSFNSLTLRFHITATINSEALHEKVQFSLLLDQSRKYRV
F
 
Nucleotide Sequence: 426 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c33813-33388 Vibrio cholerae O395 chromosome 1, complete sequence
ATGACGTACATCGCACCTGAAGAGAGTGCATTTGGTGTTGGCTTTTTCGAACGTTTGGAAGCCAACGCCA
AACCTATGTCGCTGACCCGTGGGCCAGACGCGTGGGATGTACTCGAATCGATCAAACGGAATGTCTCTAA
CATTCTGAACACTCGAATTGGTGGAGCGCAAAGTGCCCCTCATCTCGGGTTGGTGGATTTTAATGATGCA
ACGCTGGAAACCTTAGATCTCTCCGTGCGAATTAAATTGGCGATTCAACAGTGCCTTGAGCGCTATGAGC
CGCGTTTAACTCGAGCGGATCAAGATAGCTTTAACTCGCTGACTTTAAGGTTCCACATTACCGCGACCAT
CAATAGCGAAGCGTTACACGAAAAAGTCCAGTTCAGTCTGTTATTGGATCAAAGCAGAAAATATCGAGTG
TTTTAA