SecReT6
Protein ID: 147671915
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0031
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]35335..35646 [-]
Producthypothetical protein
NoteTssB
UniProt IDA5F1E1
KEGG IDvco:VC0395_0031
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.00E-30, Aligned region: 1..93
Protein Sequence: 103 a.a.     [Download]
>gi|147671915|ref|YP_001214872.1| hypothetical protein VC0395_0031 [Vibrio cholerae O395]
MRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPA
FRERLQSLLNSEESREKLLAELNLLSGQEEPQA
 
Nucleotide Sequence: 312 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c35646-35335 Vibrio cholerae O395 chromosome 1, complete sequence
ATGCGCGAGAGCGAGCTGAAAATCACCGCCACGGTGAAAAACAAGCTGACTGATGATGAGAATGCCGAGC
TTCCTGTTGAACTCAATTTCAAATCCTTAGCCGACTTCGCTCCTGATGCGGTGGCATCACAAGTTCCAGA
ACTGAAAAAATTGATTGAGTTGCGTGAAGCGTTAGTTGCCCTTAAAGGGCCGCTAGGCAACATTCCCGCA
TTTCGTGAGCGTTTACAGTCATTACTCAACTCAGAAGAGTCGAGAGAAAAACTGTTGGCAGAACTGAATC
TGCTCAGTGGTCAAGAAGAGCCACAAGCGTAA