SecReT6
Protein ID: 147671947
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0024
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]27752..28657 [-]
Producthypothetical protein
NoteTssK
UniProt IDA5F1D4
KEGG IDvco:VC0395_0024
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.80E-82, Aligned region: 19..269
Protein Sequence: 301 a.a.     [Download]
>gi|147671947|ref|YP_001214865.1| hypothetical protein VC0395_0024 [Vibrio cholerae O395]
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRIAIERAVGVMP
DGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERGTGRYVSRRLEVRDVHSVQGD
TTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSVVLDPDFIPCHLNVVGISALHRFINEMSGLM
RERAKNIAQRISSPAQGGVADVSDFMLLQALNRLQPQMKHLAELRSLHPERLFECLSCVCVVSWLPLLTK
VVCRPVCQAITMIHPATLSSR
 
Nucleotide Sequence: 906 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c28657-27752 Vibrio cholerae O395 chromosome 1, complete sequence
ATGTTTGCGCGTAACCGAGTGATCTGGAATGAAGGGCTATTTATTAAGCCGCAACATTTCCAGCAACAGC
AGAGATATACGGAGTACTGCCTAGACGAGCGCCTGAGCACCGTGAGCCGTTACTTGTATGGGATTTCCGA
GTTGTCGCTCAACCCGGAATACCTCTCGTTTGGCCGTATTGCGATTGAGCGAGCGGTCGGCGTGATGCCC
GATGGCACCACCTTTCGTATTCCTCAAGAAGATCATCTTCCCGATGCGCTCGAAGTGACCGATGCGTCAT
TGGCAAACCAGATTGTCTACTTAGCCGTACCGCTACGTAGTGAGTCGCTGATGGAGATTAACTGGCCAGA
AGAGCGTGGTACGGGGCGCTATGTCAGCCGTCGTCTCGAAGTGCGTGATGTCCACAGCGTGCAGGGTGAT
ACCACGACGATTGATGTTTCCCCTGTGCGTTTGCAACTCATGCTTGAGCGAGAGGATCGCAGTGCGTATG
CCTCAATTGCTATTGGCCGTATTTTAGAAAAACGTCCTGATGGCAGTGTGGTGCTCGATCCGGATTTCAT
CCCTTGTCACTTGAATGTGGTGGGCATCTCTGCGCTGCACCGCTTTATTAATGAGATGTCAGGCCTGATG
CGTGAGCGAGCGAAAAATATTGCTCAGCGGATCAGCTCTCCAGCACAAGGTGGGGTTGCTGATGTTTCGG
ACTTTATGCTGCTGCAAGCTTTAAACCGTCTGCAACCACAAATGAAGCATTTGGCAGAGCTGCGCAGCTT
ACACCCAGAGCGTCTGTTTGAATGTCTCTCGTGTGTGTGTGTGGTGAGCTGGCTACCTTTACTGACGAAA
GTCGTCTGCCGCCCAGTTTGCCAAGCTATAACCATGATTCACCCAGCCACTCTTTCCAGCCGCTGA