SecReT6
Protein ID: 147672179
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0015
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]15377..16642 [-]
Producthypothetical protein
NoteTssA
UniProt IDA5F1C5
KEGG IDvcr:VC395_A0114, vco:VC0395_0015
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-11, Aligned region: 47..101
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 120..136
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 172..185
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 325..397
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 123..160
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 296..340
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 380..418
Protein Sequence: 421 a.a.     [Download]
>gi|147672179|ref|YP_001214856.1| hypothetical protein VC0395_0015 [Vibrio cholerae O395]
MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACNQGMDFLICG
YYAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNARVVQELKALKPTYESLRDLYR
AERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQYHSLLKKQEKAQPPKLKFWQRGYALFTLGV
LGVALGMVGGYWGWPWFYTTPYAAPQRITTLNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTI
SFSEPKRHAITQLNLLRTLYPENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKW
AELEKQTKSLEEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALL
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c16642-15377 Vibrio cholerae O395 chromosome 1, complete sequence
GTGATGTCCAATGTGATTTTTATTGATAACGTTTGCTACCGATTAACCAATGATTCTGAGGAGATTCGCG
GATTAGAGCCCTATGCGAAGGTTCGTGAGGAGATAAACCGCCGCTTCAATCCGATTGCTGGGGGCACGGA
TTGGGCAGTGGTAAAAGAGTACTGTGAACAACTGGCCTGTAACCAAGGAATGGATTTTCTGATCTGCGGT
TACTATGCGGTAGCCTGCCTGAAAACTCAGGGGTTAGCGGGGTATGCCACCGGTATGGAGCTGATGAGTG
CAAGCCTTGCCAACCAAGGTGAGTGTGATGTGAAAAGCGCCAAAGTGCGCAAAGAGATCCTTGATTGGGT
CAATGCACGTGTGGTGCAGGAACTGAAAGCACTTAAGCCAACTTATGAGTCGCTGCGAGATCTGTATCGG
GCTGAGCGCCATTGCGAGCGGTTACATCAGCTGTTTGAACAGCAACAAACCGAATACAAAGTAGACTTTG
AAGGGGTCGGGTTTGCTCTGTTTGAACACATAGACAGAATTGAAACCCAATACCACAGCTTATTGAAAAA
GCAGGAGAAGGCTCAGCCACCTAAGCTTAAGTTTTGGCAGCGCGGTTACGCGTTGTTCACTCTAGGTGTA
CTCGGGGTTGCACTGGGAATGGTGGGGGGCTACTGGGGGTGGCCTTGGTTTTATACCACGCCTTATGCCG
CGCCACAGCGCATCACTACGTTGAATGAGGCCTCTCAAACTCAAGCACTGCTCAACGACTCTTCCACAAG
TGAGCGTGCGCGTTGGCAACATGATCTGATCCCGCTGTATCGCGATACTTTGCAGCAGAATTTAACCATC
TCGTTTAGTGAACCTAAGCGACATGCCATCACTCAGCTGAATCTATTGCGCACTCTTTATCCTGAAAACG
AGCAAGTGAATGCACTGAGTCAAGAGTTTGCCCTTCAGCAGCAACAAGCGTTGGAGCAAACCGCGCTGTT
CGTGGCTAAGTTCAGCGAAATTCGCACCAAAATGGCCAATATCTCGTTATTGGCTAAGCGAGGGAAATGG
GCTGAGTTAGAAAAGCAGACCAAATCATTAGAAGAGTTCGCGGTCAGCCTATCACCGATTTATGGTCGAG
TTGACTATGTGCAAGGCCTCCTTGAACAGGGCGATGTCACAAATGCCCAGAAAGAGTTTGCGATCCTCAA
ACAAAGGCTAGATAGCCTAAGTTGGAAAATTGCCGAGCTTGAGCAGCGTATCGGCGATGCGGCTTTGTTG
CAGTGA