SecReT6
Protein ID: 147672311
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0023
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]27321..27800 [-]
Producthypothetical protein
NoteTssK
UniProt IDA5F1D3
KEGG IDvco:VC0395_0023
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.20E-66, Aligned region: 1..158
GMP_synt_C [PF00958], Evalue: 0.00016, Aligned region: 17..89
Protein Sequence: 159 a.a.     [Download]
>gi|147672311|ref|YP_001214864.1| hypothetical protein VC0395_0023 [Vibrio cholerae O395]
MPSYNHDSPSHSFQPLIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVKARMPL
DELRRLFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTHSSGFA
FHVAAAFDDLELQFWAIRS
 
Nucleotide Sequence: 480 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c27800-27321 Vibrio cholerae O395 chromosome 1, complete sequence
TTGCCAAGCTATAACCATGATTCACCCAGCCACTCTTTCCAGCCGCTGATCCGCAGCTTGCGTCAGAGCT
TGAGCGTGGTGCTAGAGCCGCGTGCCGTCTCTATCCAACTGGATAAACGTAAGTACGGTTTGATGGTTGC
GCCAATCCATGATCCGCAACTGATGGAGAGTGCAGAGTTTATCATCGCGGTTAAAGCTCGCATGCCGTTG
GATGAGCTACGCCGTCTGTTTACTCAGCAAACCAAAGTGGCATCGGTTGAGAAAATTCGTGAACTCATCT
CACTGCAACTGCCGGGTATTCCATTGACGCCATTACCCGTCGCACCGCGCCAATTGCCTTACCACGCTGG
CTACACCTACTACCAACTGGATAAAACCAGCGCTGCATGGGCGATGTTGACTCATTCCAGCGGTTTTGCG
TTCCACGTTGCTGCAGCTTTTGACGATCTTGAGCTGCAATTCTGGGCTATCAGGAGCTAA