SecReT6
Protein ID: 147672397
SecReT6 ID208
T6SS typei1
Gene symbol-
Locus tagVC0395_0032
StrainVibrio cholerae O395
Repliconchromosome I [GenBank: NC_009456] [Browse all T6SS(s) in this replicon]
Location [Strand]35666..35842 [-]
Producthypothetical protein
NoteTssB
UniProt IDA5F1E2
KEGG IDvco:VC0395_0032
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.60E-17, Aligned region: 5..58
Protein Sequence: 58 a.a.     [Download]
>gi|147672397|ref|YP_001214873.1| hypothetical protein VC0395_0032 [Vibrio cholerae O395]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVD
 
Nucleotide Sequence: 177 bp     [Download]
>gi|147671401|ref|NC_009456.1|:c35842-35666 Vibrio cholerae O395 chromosome 1, complete sequence
ATGTCTAAAGAAGGAAGTGTAGCTCCCAAAGAGCGGATTAATATCAAGTATATTCCGGCGACGGGGGATG
CACAGGCTGAGGTTGAGCTACCACTCAAAACCCTAGTTGTAGGTGATTTCAAAGGGCATGCGGAGCAAAC
CCCATTGGAAGAGCGTGCAACAGTCACGGTAGATTAA