SecReT6
Protein ID: 148261080
SecReT6 ID209
T6SS typeN/A
Gene symbol-
Locus tagAcry_2089
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]2301634..2303004 [-]
ProductOmpA/MotB domain-containing protein
NoteTssL
UniProt IDA5G0A6
KEGG IDacr:Acry_2089
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-66, Aligned region: 66..270
OmpA [PF00691], Evalue: 2.60E-14, Aligned region: 346..444
Protein Sequence: 456 a.a.     [Download]
>gi|148261080|ref|YP_001235207.1| OmpA/MotB domain-containing protein [Acidiphilium cryptum JF-5]
MSDNPFAEPDDSDRTIIRPAPGGRRPPPAPPPPPPTGGGDPWSEPPRPASPPPAGGAETLNIGSTPLMAA
AAPLLQLLARLRNTLAQPDSGDLRERTARALRDFEQAGRNAGIPNDQLRPAHYALCASLDDVVLATPWGS
SGAWAARSMVSTFHQEVRSGERFFDILKQIMQNPGRFLPVLELMYICLSLGYMGRYRLSPRGPAEIDRLR
EDVYAVLRRARPAASPELAPHWQGVAAPYRPRRPSLPVWVAAVAAAGVLALVYAAFDYGLGGQSATLYAQ
SVAAHPARMPKIVRAAAVVPPPPPVTTGPNVLDRLRGFLQPEITKGEVAVLGTVNAPVIRINNTGLFASG
SATVESTALPLISKIGQALAREKGKVQVIGYTDSQPIHTLRFPNNLVLSEDRAKAAAAVLDRAIGDQSRI
TAEGRGAADPIATNATPQGRALNRRIEIVLIRSETQ
 
Nucleotide Sequence: 1371 bp     [Download]
>ref|NC_009484.1|:c2303004-2301634 OmpA/MotB domain-containing protein [Acidiphilium cryptum JF-5]
ATGAGCGACAATCCGTTTGCCGAACCAGACGATTCCGACCGCACGATCATCAGGCCGGCGCCGGGCGGCC
GGCGTCCCCCGCCCGCGCCGCCGCCGCCGCCGCCAACCGGCGGTGGCGACCCTTGGAGCGAGCCGCCGCG
GCCGGCATCCCCGCCGCCCGCGGGCGGCGCGGAGACGCTGAATATCGGCTCGACGCCGCTGATGGCGGCC
GCGGCCCCCCTGCTGCAGTTGCTCGCTCGCTTGCGCAACACCCTGGCCCAGCCCGATTCGGGCGATCTGC
GCGAACGCACCGCCCGCGCGTTGCGCGACTTCGAGCAGGCGGGCCGCAATGCGGGCATTCCGAACGACCA
GCTGCGCCCCGCGCATTACGCCCTGTGCGCCAGCCTCGATGACGTGGTGCTCGCCACCCCCTGGGGCAGC
AGCGGCGCCTGGGCCGCGCGCTCGATGGTGTCCACCTTCCATCAGGAGGTCCGCTCCGGCGAGCGCTTCT
TCGACATCCTCAAGCAGATCATGCAGAACCCGGGCCGGTTCCTGCCGGTTCTCGAGCTGATGTATATCTG
CCTCTCGCTCGGCTACATGGGGCGCTACCGGCTCAGTCCGCGCGGCCCCGCCGAGATCGACCGGCTGCGC
GAGGATGTCTATGCCGTCCTCCGCCGCGCCCGCCCGGCCGCCAGCCCCGAACTGGCGCCCCACTGGCAGG
GCGTTGCGGCGCCCTACCGCCCGCGCCGCCCGTCCCTGCCGGTCTGGGTCGCCGCGGTGGCGGCCGCCGG
GGTGCTGGCCCTTGTCTACGCGGCCTTCGACTACGGGCTCGGCGGCCAGTCCGCCACGCTCTACGCGCAG
TCGGTCGCCGCCCACCCGGCGCGGATGCCGAAGATCGTCCGCGCCGCCGCCGTCGTGCCGCCGCCGCCGC
CGGTCACCACCGGCCCGAACGTGCTCGACCGGCTGCGCGGCTTCCTGCAACCCGAAATCACCAAGGGCGA
GGTCGCCGTGCTCGGCACCGTCAACGCGCCGGTCATCCGCATCAACAACACCGGCCTGTTCGCCTCCGGC
AGCGCGACGGTCGAGAGCACCGCGCTGCCGCTGATTTCCAAGATCGGCCAGGCGCTGGCGCGCGAGAAGG
GCAAGGTGCAGGTGATCGGCTATACCGACAGCCAGCCGATCCACACGCTGCGCTTCCCCAACAACCTGGT
CCTCTCGGAGGACCGCGCGAAGGCGGCGGCCGCCGTGCTCGACCGCGCGATCGGCGATCAGAGCCGCATC
ACCGCGGAGGGGCGCGGCGCCGCCGACCCGATCGCGACCAACGCGACGCCGCAGGGGCGCGCCCTGAACC
GGCGGATCGAAATCGTGCTGATCCGGAGTGAAACCCAATGA