SecReT6
Protein ID: 148261081
SecReT6 ID209
T6SS typeN/A
Gene symbol-
Locus tagAcry_2090
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]2303015..2304346 [-]
Producthypothetical protein
NoteTssK
UniProt IDA5G0A7
KEGG IDacr:Acry_2090
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.20E-161, Aligned region: 19..442
Protein Sequence: 443 a.a.     [Download]
>gi|148261081|ref|YP_001235208.1| hypothetical protein Acry_2090 [Acidiphilium cryptum JF-5]
MSWTNRVVWQEGMFLRSQHFQQQDRWLEAQVRGRVAALRPYPWGISRLAVNRELLGTGRFALAEAEGVFE
DGTCFSLPGEADHPPPFEVPENTRNMLLHLALPVRQPGAAEIAAEDGSTEGRYGAARFEAYDTHSASPEP
AELLIARLRLRYLLDSEDRAGFLCLPVARIVEVSADRRVTLDDRWIPPALVCHAAPPLAGLIAEFSGMIH
QRGEALAARLNAPGTRGVAEVQDFMLLQAINRWQAMLQHWADAAVIHPETLYSAFVSMAGEFATFIEGSR
RPTAYPGYRHDDLQRSFAPVVADLRRALSAVIEQNAVPIPLQERRHGVHVGPIVDRSILRAANFVLTVQA
DVPAETLRRLFPAQVKIGAVEHIRELVNVALPGISVRPLPVAPRQIPFYAGATYFELDRGSPHWQQMQNS
GAFALHVSGEFPGLKLELWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>ref|NC_009484.1|:c2304346-2303015 hypothetical protein Acry_2090 [Acidiphilium cryptum JF-5]
ATGAGCTGGACCAACAGGGTCGTCTGGCAGGAAGGCATGTTCCTGCGCTCGCAGCATTTCCAGCAACAGG
ACCGTTGGCTCGAAGCCCAGGTGCGCGGCCGGGTGGCGGCGCTGCGGCCCTATCCGTGGGGAATCTCCCG
TCTCGCGGTCAACCGGGAACTGCTCGGCACCGGCCGTTTCGCCCTGGCCGAGGCTGAAGGCGTGTTCGAG
GACGGAACCTGCTTCTCCCTGCCGGGCGAGGCCGATCATCCGCCGCCGTTCGAGGTGCCCGAGAACACGC
GCAACATGCTGCTTCACCTCGCGCTGCCGGTGCGCCAGCCCGGCGCCGCCGAGATCGCCGCGGAAGACGG
CAGCACCGAGGGACGCTACGGCGCCGCCCGCTTCGAGGCCTACGACACGCATTCCGCCTCGCCCGAGCCG
GCGGAGCTGCTGATCGCCCGGCTGCGCCTGCGCTATCTCCTCGACAGCGAGGACCGCGCCGGCTTCCTCT
GCCTGCCGGTCGCGCGGATCGTCGAGGTTTCGGCCGACCGGCGCGTGACGCTGGATGACCGCTGGATCCC
GCCGGCGCTGGTCTGTCACGCGGCGCCGCCGCTCGCCGGGCTGATCGCCGAATTCTCCGGCATGATCCAC
CAGCGTGGCGAGGCGCTCGCCGCCCGGCTCAATGCGCCGGGCACGCGCGGCGTCGCCGAGGTGCAGGATT
TCATGCTGCTCCAGGCGATCAACCGCTGGCAGGCGATGCTCCAGCACTGGGCCGACGCCGCCGTGATCCA
TCCGGAGACCCTCTATTCCGCCTTCGTCTCGATGGCCGGCGAGTTTGCCACCTTCATCGAGGGCAGCCGC
CGGCCCACCGCCTATCCCGGTTACCGGCACGACGATCTGCAACGCAGCTTCGCGCCGGTCGTCGCCGATC
TGCGGCGGGCGCTCTCGGCGGTCATCGAACAGAACGCCGTGCCGATCCCGCTGCAGGAGCGGCGCCACGG
CGTTCATGTCGGCCCGATCGTCGACCGCAGCATCCTGCGCGCCGCGAATTTCGTCCTGACCGTGCAGGCC
GACGTGCCGGCCGAGACCCTGCGCCGGCTGTTCCCCGCGCAGGTGAAGATCGGCGCCGTCGAGCATATCC
GCGAACTGGTCAACGTCGCGTTGCCCGGCATCTCGGTGCGGCCGCTCCCGGTGGCGCCCCGGCAGATCCC
TTTCTATGCCGGCGCCACCTATTTCGAGCTCGATCGCGGCAGTCCGCACTGGCAGCAGATGCAGAATTCA
GGCGCGTTCGCACTGCACGTATCGGGCGAATTTCCGGGGCTGAAACTCGAACTCTGGGCGATCCGCGGCT
GA