SecReT6
Protein ID: 148261082
SecReT6 ID209
T6SS typeN/A
Gene symbol-
Locus tagAcry_2091
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]2304353..2304823 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA5G0A8
KEGG IDacr:Acry_2091
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-31, Aligned region: 12..144
Protein Sequence: 156 a.a.     [Download]
>gi|148261082|ref|YP_001235209.1| hypothetical protein Acry_2091 [Acidiphilium cryptum JF-5]
MKRRSIILALPVLLAGCGTPPPKPPAVLSLTITGGANQNPDASGTAEPVAVRVYPLVTAGKFNAADPYSL
LGKATSLLGSDLAGPSEQTIVAPGATVKLTHKLPDQAQSIGIAVFFRAIDRATWRLVAPVKAHETNALTL
RIDGLDAKLVPTKPKG
 
Nucleotide Sequence: 471 bp     [Download]
>ref|NC_009484.1|:c2304823-2304353 hypothetical protein Acry_2091 [Acidiphilium cryptum JF-5]
GTGAAGCGCCGTTCGATCATCCTCGCACTTCCTGTCCTCCTTGCCGGCTGCGGCACGCCGCCGCCGAAGC
CGCCGGCGGTGCTGTCGCTGACCATCACGGGCGGGGCCAACCAGAACCCCGATGCCTCGGGCACTGCCGA
GCCGGTGGCCGTGCGGGTCTACCCGCTGGTCACCGCCGGCAAGTTCAATGCCGCCGACCCGTATTCGTTG
CTCGGCAAGGCCACGTCCCTGCTCGGCAGCGACCTCGCCGGTCCGTCGGAGCAGACGATCGTCGCGCCCG
GCGCCACGGTGAAGCTGACGCACAAATTGCCGGATCAGGCGCAGTCGATCGGCATCGCCGTGTTCTTCCG
GGCGATCGACCGGGCGACATGGCGCCTCGTCGCGCCGGTGAAGGCGCATGAAACGAACGCGCTGACCTTG
CGGATCGACGGATTGGACGCCAAGCTCGTCCCAACCAAACCGAAGGGCTGA