SecReT6
Protein ID: 148261083
SecReT6 ID209
T6SS typeN/A
Gene symbol-
Locus tagAcry_2092
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]2304820..2306211 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDA5G0A9
KEGG IDacr:Acry_2092
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.30E-18, Aligned region: 27..95
Protein Sequence: 463 a.a.     [Download]
>gi|148261083|ref|YP_001235210.1| FHA domain-containing protein [Acidiphilium cryptum JF-5]
MTLTLSVLRCPDAAPPETRSIEGGEFRIGRGPDNDWVLTDPDRVLSKRHCVIAWRAGAWQIADTSTNGTF
VNQDIEPLGAGRVHALSDGDRIRLGSYEIEARLVERGFGDAGYGGGFGAAPATRPDPFADPFGEDPFAKP
AAPVSSPVSDEWFGGGNSISMPDDFAGLPDDDALFGPTPVPDHSPAQNDVFRPAPMAPKLLPDDWDLGLE
PGANTASAGPAWTAPSPLPPPAEIQPPPPAAPAPPAPLPPAPLPPAPVPAAPVPAGAPGGDLLRIFLEAA
GMDGLPPPADPELLMRRLAGLFRAMVGGLRQVMIARAAIKGEFRIEQTMIRARGNNPLKFSADDDDAMAA
LIGLGRRTSDLQAEEAVRDALRDIRLHEIAVMSGMQAAVRALFARLDPAPLRAEAESARALLPAQRKARA
FEAYETLYGQLSAALADDFDNVFGKTFARAYERALSDAEASET
 
Nucleotide Sequence: 1392 bp     [Download]
>ref|NC_009484.1|:c2306211-2304820 FHA domain-containing protein [Acidiphilium cryptum JF-5]
ATGACCCTCACCCTCAGCGTGCTCCGCTGCCCGGATGCCGCCCCGCCGGAAACCCGCAGCATCGAGGGCG
GGGAATTCCGCATCGGCCGCGGTCCGGACAATGACTGGGTGCTCACCGATCCCGATCGCGTGCTGTCCAA
GCGGCATTGCGTGATCGCCTGGCGTGCCGGCGCCTGGCAGATCGCCGACACCAGCACCAACGGCACATTC
GTCAATCAGGACATCGAGCCGCTTGGCGCCGGCCGCGTTCACGCGCTGAGCGACGGCGACCGGATCCGGC
TGGGCAGCTACGAAATCGAAGCCCGTCTCGTCGAGCGCGGCTTCGGGGATGCGGGATATGGCGGTGGTTT
CGGCGCCGCGCCCGCGACCCGGCCGGACCCCTTCGCCGATCCGTTCGGCGAGGACCCGTTCGCCAAACCC
GCGGCACCCGTCTCCTCTCCCGTATCCGACGAGTGGTTCGGCGGCGGCAATTCGATTTCGATGCCCGACG
ACTTTGCCGGCCTGCCGGATGACGATGCCCTGTTCGGCCCGACGCCGGTGCCCGACCACTCGCCGGCGCA
GAACGACGTCTTCCGCCCCGCGCCGATGGCGCCGAAACTTCTGCCCGATGACTGGGATCTGGGCCTCGAA
CCCGGCGCCAACACGGCGTCGGCCGGCCCGGCATGGACGGCGCCTTCGCCGCTGCCGCCGCCCGCCGAGA
TCCAGCCGCCTCCACCGGCCGCTCCGGCGCCGCCCGCTCCCCTGCCGCCCGCTCCCCTGCCGCCCGCCCC
CGTGCCGGCCGCTCCCGTGCCGGCCGGCGCGCCCGGCGGCGATCTGCTCAGGATCTTTCTCGAGGCCGCG
GGCATGGACGGGCTGCCGCCGCCGGCGGATCCGGAACTGCTGATGCGTCGCCTCGCCGGTCTGTTCCGCG
CCATGGTGGGCGGGCTGCGCCAGGTGATGATCGCCCGCGCCGCGATCAAGGGCGAATTCCGGATCGAACA
GACGATGATCCGCGCGCGCGGCAACAACCCGCTCAAATTCTCGGCGGATGACGACGATGCGATGGCCGCG
CTGATCGGCCTCGGCCGCCGCACCAGCGACCTGCAGGCCGAGGAGGCGGTGCGGGACGCGCTGCGCGATA
TCCGCCTGCACGAGATCGCGGTGATGAGCGGCATGCAGGCCGCGGTGCGCGCCCTGTTCGCCCGGCTCGA
TCCCGCGCCGCTGCGGGCGGAGGCCGAATCGGCGCGCGCGCTGCTGCCGGCCCAGCGCAAGGCGCGCGCC
TTCGAGGCCTATGAAACATTGTATGGCCAGCTCAGCGCGGCCCTTGCCGACGATTTCGACAACGTCTTCG
GCAAGACCTTTGCCCGCGCCTACGAGCGCGCCCTGTCGGATGCGGAGGCCAGTGAAACGTGA