SecReT6
Protein ID: 148261085
SecReT6 ID209
T6SS typeN/A
Gene symbol-
Locus tagAcry_2094
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]2306806..2308746 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA5G0B1
KEGG IDacr:Acry_2094
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-56, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 202..246
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 364..451
Phage_base_V [PF04717], Evalue: 5.00E-23, Aligned region: 489..499
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 334..342
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 508..531
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 532..555
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 549..570
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 566..583
Gp5_C [PF06715], Evalue: 3.90E-11, Aligned region: 591..597
Protein Sequence: 646 a.a.     [Download]
>gi|148261085|ref|YP_001235212.1| Rhs element Vgr protein [Acidiphilium cryptum JF-5]
MTTNIDLLDLQTSLGSGVLTLVGVNGQAALSQCFRYTLSVRAGAGGLDPNDLLYTSVTVAIGSDGTNQTY
INGLVSSVVQKPGNAAGTAIAAGLELWDHELTVVPALWFLGQTLDCRIFQNKTAVAIVKEVLDEFEITSY
ELPSGGTSYDYTVMFNETYLDFINRILARDGLFYYFVHEKSGHKFVVASSSQSLPKLGAVKFAGQTATEV
GVHTLSRADSTTIGKFIGNDYNYETASTGLVSDADTVLKAKGAATRKFYRYPSENPVKEAIGQQVRHQNE
AAEVRAGLFAGGGNTPSMLAPGNAVTITGDPFGIGDYVIAAAALSVTDHAGIGGGTATVDVAFTLFDASV
PWRPELLPKPQIAGLQSALVVGPSGDEIYTNKYGRVKVQFNWDTRGKKDENSSCWVRVIQPWAGAGWGFQ
FLPRIGQEVAISFLESDIDRPVVIGSFYNSGQVSLFNLPAEQNKAGFRSRSTKSGGTSNYSEFSIDDTKG
SEVVLLHAERDYTVEVEHDETRTIGNNRTVTVKKDEAITVDGNQTETVKGNRTFEVKQDHSETVDGNQSV
TVKGKQSVSVQGQQSVSVTGAVTYESMESITLKVGGNSIKIDMTGITLSGTLIKINAQAELSTSGAIAQH
SGSGMLKLQGGIIMVN
 
Nucleotide Sequence: 1941 bp     [Download]
>ref|NC_009484.1|:c2308746-2306806 Rhs element Vgr protein [Acidiphilium cryptum JF-5]
ATGACGACTAATATCGATCTGCTTGACCTCCAGACATCGCTTGGTAGCGGCGTCCTGACGCTGGTCGGGG
TCAATGGCCAGGCGGCGCTCAGCCAGTGCTTCCGGTATACGCTGTCGGTGCGCGCGGGTGCCGGCGGGCT
CGATCCGAACGATCTTCTATACACGTCGGTCACCGTCGCGATCGGGTCCGACGGGACGAACCAGACCTAC
ATCAATGGCCTCGTCTCGTCCGTGGTCCAGAAGCCCGGCAACGCGGCCGGTACCGCGATCGCCGCCGGCC
TCGAACTCTGGGATCATGAACTGACGGTCGTTCCCGCCCTCTGGTTCCTCGGGCAGACACTCGATTGCCG
GATATTCCAGAACAAGACCGCCGTTGCCATCGTCAAGGAAGTTCTGGACGAATTCGAGATTACTTCATAC
GAGCTGCCGAGTGGCGGGACGAGCTATGACTATACAGTCATGTTCAATGAGACCTATCTGGACTTCATAA
ATCGCATCCTCGCGCGCGATGGGCTTTTCTATTATTTCGTCCACGAAAAGTCCGGACACAAGTTCGTCGT
CGCCAGCAGCTCGCAATCTCTCCCCAAGTTGGGAGCCGTCAAATTCGCCGGGCAGACCGCGACCGAAGTC
GGGGTTCATACGCTCAGCCGCGCCGACAGCACGACCATCGGCAAGTTCATCGGGAACGACTACAACTATG
AAACGGCATCCACCGGCCTCGTCTCCGATGCGGATACCGTGCTCAAGGCGAAGGGGGCGGCAACCCGCAA
ATTCTATCGCTACCCGTCGGAAAATCCCGTCAAGGAGGCGATCGGACAGCAGGTGCGCCATCAGAACGAG
GCGGCCGAGGTTCGTGCCGGGTTGTTCGCCGGTGGCGGCAACACCCCGTCGATGCTCGCTCCCGGCAACG
CCGTCACCATCACCGGCGATCCCTTCGGCATCGGCGATTACGTCATTGCGGCGGCCGCGCTCAGCGTGAC
CGATCACGCCGGCATCGGCGGAGGGACGGCCACCGTCGATGTCGCATTCACCCTGTTCGACGCATCCGTT
CCCTGGCGGCCGGAACTCCTGCCGAAGCCGCAGATCGCCGGCTTGCAGTCCGCCCTCGTCGTCGGGCCCT
CGGGCGATGAAATTTACACGAACAAGTACGGCCGGGTGAAGGTTCAGTTCAACTGGGACACGCGCGGCAA
GAAGGACGAGAACTCGAGTTGCTGGGTTCGCGTGATCCAGCCCTGGGCCGGCGCCGGCTGGGGGTTCCAG
TTCCTTCCGCGCATCGGCCAGGAGGTCGCCATCAGCTTCCTCGAGAGCGACATCGACCGGCCGGTCGTGA
TCGGTTCCTTCTACAACTCCGGCCAGGTCAGCCTGTTCAATCTCCCCGCCGAGCAGAACAAGGCGGGATT
CCGCTCCCGCTCAACCAAGAGTGGCGGGACGTCGAACTACAGCGAATTCAGTATCGACGATACCAAGGGT
TCGGAGGTTGTCCTGCTGCATGCGGAGCGGGATTATACGGTCGAGGTCGAGCATGATGAAACCCGCACGA
TCGGCAACAACCGCACGGTGACCGTCAAGAAGGACGAGGCGATCACCGTGGACGGCAACCAGACCGAGAC
GGTGAAAGGAAATCGTACCTTCGAGGTCAAGCAGGACCATTCCGAGACGGTCGATGGCAACCAGTCCGTC
ACGGTCAAGGGCAAGCAGAGCGTGTCGGTGCAGGGGCAGCAATCCGTATCCGTGACCGGGGCCGTCACCT
ATGAGTCGATGGAGTCGATCACGCTGAAAGTGGGCGGAAACAGCATCAAGATCGACATGACGGGCATCAC
GCTCTCCGGCACCCTCATCAAGATCAATGCCCAGGCCGAGCTGTCGACGAGCGGCGCGATTGCGCAGCAT
TCCGGCTCGGGGATGCTGAAACTCCAGGGCGGGATCATCATGGTGAACTGA