SecReT6
Protein ID: 148262050
SecReT6 ID210
T6SS typei5
Gene symbol-
Locus tagAcry_3070
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]3351662..3352780 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA5G326
KEGG IDacr:Acry_3070
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 62..122
Protein Sequence: 372 a.a.     [Download]
>gi|148262050|ref|YP_001236177.1| ImpA domain-containing protein [Acidiphilium cryptum JF-5]
MILDIDALLAPIEGDSPVGQDLRADYTAGSIYYRLRDARSDARAAERAADSDPTLEADAGQHWRSVLQLA
QTALGKSHDLEVAAWMTEAMVRENGLAGLAEGARLMAGLVQGFWEALYPLPDEDGMETRVAPVAGLNGTG
SDGTLIQPLRKLTLFNAADGSPVPVFLYLQAEETAGLGDEKRKAARIAAGVPAFAQLETQARVAGTGHFT
ALARGAAAALEAWQAMGAAFDEVAGYDAPPTSRVREVLEQIIAISQRYAPGALAAPGGAAENADAAAGAE
AAGAAEDAVAVDGPAPAQAAKKPYTREDALRQLGEIAEFFRRTEPQSPIALTLDEAIRRARLTWPELIED
ILADAGVRQAMLTALGIKPPAD
 
Nucleotide Sequence: 1119 bp     [Download]
>ref|NC_009484.1|:3351662-3352780 ImpA domain-containing protein [Acidiphilium cryptum JF-5]
ATGATTCTCGACATCGACGCCTTGCTTGCCCCGATTGAAGGGGATTCGCCGGTCGGGCAGGACTTGCGTG
CCGACTACACCGCGGGCTCGATTTACTATCGCCTGCGCGATGCGCGCTCGGACGCGCGCGCCGCCGAGCG
CGCGGCGGATTCGGATCCGACGCTTGAGGCCGACGCGGGACAGCATTGGCGCAGCGTGCTGCAACTGGCG
CAAACCGCGCTCGGCAAGTCGCACGACCTGGAGGTTGCCGCCTGGATGACCGAGGCGATGGTGCGCGAGA
ACGGGCTTGCCGGTCTTGCCGAGGGGGCTCGGCTGATGGCGGGCCTTGTCCAGGGGTTCTGGGAGGCGCT
TTACCCGTTGCCCGACGAGGACGGCATGGAAACGCGCGTCGCGCCCGTGGCCGGCCTGAACGGGACGGGA
AGCGATGGCACGCTGATCCAGCCGCTGCGCAAGCTGACACTGTTCAACGCCGCCGACGGGTCGCCTGTGC
CCGTCTTCTTGTATCTCCAGGCGGAGGAGACGGCAGGGCTCGGCGACGAGAAACGCAAGGCGGCGCGGAT
CGCCGCTGGCGTGCCGGCCTTCGCACAGCTGGAGACACAGGCGCGGGTGGCGGGTACGGGCCATTTCACC
GCGCTCGCGCGCGGCGCGGCGGCAGCACTCGAGGCCTGGCAGGCGATGGGGGCGGCCTTCGATGAGGTGG
CCGGGTATGACGCACCGCCGACCTCGCGGGTACGGGAGGTGCTCGAGCAGATCATCGCCATTTCACAACG
ATATGCGCCCGGCGCGCTGGCCGCGCCCGGCGGCGCGGCGGAGAACGCTGACGCAGCCGCCGGAGCGGAG
GCGGCCGGAGCCGCCGAGGATGCCGTCGCCGTTGACGGCCCGGCGCCGGCGCAGGCCGCGAAGAAGCCCT
ATACGCGTGAGGATGCGCTGCGCCAGCTTGGCGAGATCGCCGAATTCTTCCGCCGCACCGAACCGCAATC
GCCGATTGCGCTGACCCTCGATGAGGCGATCCGCCGTGCGCGGCTCACCTGGCCGGAACTGATCGAGGAT
ATTCTGGCCGACGCCGGCGTGCGCCAGGCGATGCTGACGGCGCTCGGCATCAAGCCGCCGGCGGACTGA