SecReT6
Protein ID: 148262052
SecReT6 ID210
T6SS typei5
Gene symbol-
Locus tagAcry_3072
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]3354316..3355809 [-]
Producthypothetical protein
NoteTssC
UniProt IDA5G328
KEGG IDacr:Acry_3072
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-191, Aligned region: 64..494
Protein Sequence: 497 a.a.     [Download]
>gi|148262052|ref|YP_001236179.1| hypothetical protein Acry_3072 [Acidiphilium cryptum JF-5]
MSQSQSETAAAGATQTGEAVSLLDQVVGATKQTEPDHAQELVKTLVQEALSGTVTFDKNLTRTIDRAIAA
IDARMSRQLNAIMHDAKFLKLEGSWRGLHHLVMNSETGTSLKLKVINMSKRDLNKDLTKAVEFDQSQLFK
KIYENEFGTPGGEPYGALIGDYEWSNHPDDIETLRLVSNVAAAAFAPFISAAGAGMFGFQDWTELSKPRD
LAKIFDTAEYAKWRGFRETEDARFVSLVMPRTLARVPYGASTSPVESFNYEEAPFDASGAARPMDHHDYC
WMNAAYMMGERLTASFASSGFCVAIRGAEGGGKVENLPFHVFQSDDGDTDAKCPTEIGITDRREFELSNL
GFLPLCHYKNTDYAVFFGAQSVQKPKKYDRPDATANAAISARLPYIMASSRFAHFLKVMARDKIGSFMEA
KDCENWLNRWIGNYVNANPDAGQEMKARYPLREAKVEVKEIPGKPGSYNAVAYLRPWLQMEELTTSMRMV
ARIPQKA
 
Nucleotide Sequence: 1494 bp     [Download]
>ref|NC_009484.1|:c3355809-3354316 hypothetical protein Acry_3072 [Acidiphilium cryptum JF-5]
ATGTCACAGAGCCAATCCGAAACGGCGGCAGCCGGCGCAACGCAAACCGGGGAAGCCGTCTCGCTGCTCG
ACCAGGTCGTCGGCGCAACCAAGCAGACCGAGCCCGATCATGCCCAGGAACTCGTCAAGACGCTCGTCCA
GGAAGCCCTCTCCGGCACCGTCACCTTCGACAAGAACCTCACCCGCACGATCGACCGCGCCATCGCCGCG
ATCGACGCGCGGATGTCCCGCCAGCTCAACGCGATCATGCACGACGCGAAATTCCTCAAGCTCGAGGGCA
GCTGGCGCGGCCTGCATCACCTGGTGATGAACTCCGAGACGGGCACGTCGCTCAAGCTCAAGGTCATCAA
CATGTCGAAGCGGGATCTGAACAAGGATCTCACCAAGGCCGTCGAGTTCGACCAGAGCCAGCTCTTCAAG
AAGATCTACGAGAACGAGTTCGGCACTCCCGGTGGCGAGCCCTATGGCGCGCTGATCGGCGACTACGAAT
GGTCGAACCATCCGGACGACATCGAGACTCTGCGCCTCGTCTCCAACGTCGCTGCGGCGGCCTTCGCGCC
GTTCATCTCGGCGGCTGGTGCGGGCATGTTCGGCTTCCAGGACTGGACGGAACTCTCAAAGCCGCGCGAC
CTCGCCAAGATCTTCGACACCGCCGAATACGCGAAATGGCGCGGCTTCCGCGAAACCGAGGATGCGCGCT
TCGTCTCGCTGGTGATGCCGCGCACCCTCGCCCGCGTGCCCTACGGCGCCAGCACCTCGCCGGTGGAGAG
CTTCAACTACGAGGAAGCGCCGTTCGATGCGAGCGGCGCCGCCCGGCCGATGGACCATCACGACTATTGC
TGGATGAACGCGGCCTACATGATGGGCGAGCGGCTGACCGCGAGCTTCGCCTCCTCGGGCTTCTGCGTCG
CGATCCGCGGCGCCGAGGGCGGCGGCAAGGTCGAGAACCTGCCCTTCCACGTCTTCCAGTCCGATGACGG
CGACACCGACGCGAAATGCCCGACTGAAATCGGCATCACCGACCGGCGCGAGTTCGAGCTTTCCAATCTC
GGCTTCCTGCCGCTCTGCCACTACAAGAACACCGACTATGCCGTGTTCTTCGGCGCCCAGTCGGTGCAGA
AGCCGAAGAAATACGACCGGCCGGACGCCACCGCTAACGCCGCGATCTCCGCTCGCCTGCCCTACATCAT
GGCCTCCTCCCGCTTCGCGCATTTCCTCAAGGTGATGGCGCGCGACAAGATCGGCTCCTTCATGGAGGCG
AAGGACTGCGAGAATTGGCTGAACCGCTGGATCGGCAACTATGTCAACGCCAACCCCGATGCCGGCCAGG
AAATGAAGGCCCGATATCCGCTGCGCGAGGCCAAGGTCGAGGTCAAGGAGATCCCGGGTAAGCCCGGCTC
CTACAACGCGGTGGCCTATCTGCGTCCCTGGCTGCAGATGGAGGAACTGACGACCTCGATGCGGATGGTC
GCTCGGATCCCGCAGAAGGCCTGA