SecReT6
Protein ID: 148262053
SecReT6 ID210
T6SS typei5
Gene symbol-
Locus tagAcry_3073
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]3355813..3356319 [-]
Producthypothetical protein
NoteTssB
UniProt IDA5G329
KEGG IDacr:Acry_3073
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.30E-63, Aligned region: 9..163
Protein Sequence: 168 a.a.     [Download]
>gi|148262053|ref|YP_001236180.1| hypothetical protein Acry_3073 [Acidiphilium cryptum JF-5]
MSGSIHEKLNRVRKPRVHITYDVETDGAQIARELPFVMGVMGDFSGDPTQPLKPLSERKFVQIDRDNFND
VMARMAPGLKLKVDNTLADDGTQMAVDLKFNSIEDFDPERVVEQVPALKSLLETRNKLRDLMSKADRSEE
LESLLEQVLQNEAELKSLSGELGLGKEG
 
Nucleotide Sequence: 507 bp     [Download]
>ref|NC_009484.1|:c3356319-3355813 hypothetical protein Acry_3073 [Acidiphilium cryptum JF-5]
ATGAGTGGCAGTATCCACGAGAAACTCAACCGCGTACGGAAGCCGCGCGTGCACATTACCTACGATGTCG
AAACCGACGGCGCGCAGATCGCACGCGAACTGCCATTCGTGATGGGCGTGATGGGCGATTTCTCCGGCGA
CCCGACGCAGCCGCTGAAGCCGCTGTCGGAGCGGAAATTCGTCCAGATCGACCGCGACAACTTCAACGAT
GTCATGGCCCGCATGGCGCCCGGCCTGAAGCTGAAGGTGGACAACACCCTGGCCGATGACGGCACGCAGA
TGGCGGTTGACCTGAAATTCAACAGCATCGAGGATTTCGATCCCGAGCGTGTCGTCGAGCAGGTTCCTGC
CCTCAAATCCTTGCTGGAGACGCGCAACAAGCTGCGCGACCTGATGAGCAAGGCCGATCGATCGGAAGAA
CTTGAGTCGCTGCTTGAACAGGTTCTTCAGAATGAAGCCGAACTGAAATCGCTCTCGGGCGAACTCGGCC
TCGGCAAGGAGGGCTGA