SecReT6
Protein ID: 148262054
SecReT6 ID210
T6SS typei5
Gene symbol-
Locus tagAcry_3074
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]3356647..3357462 [+]
Productvirulence protein, SciE type
NoteTagJ
UniProt IDA5G330
KEGG IDacr:Acry_3074
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.80E-36, Aligned region: 147..270
TPR_19 [PF14559], Evalue: 1.80E-07, Aligned region: 16..72
TPR_19 [PF14559], Evalue: 1.80E-07, Aligned region: 106..134
TPR_16 [PF13432], Evalue: 0.00038, Aligned region: 15..73
TPR_16 [PF13432], Evalue: 0.00038, Aligned region: 101..135
TPR_14 [PF13428], Evalue: 0.0098, Aligned region: 15..49
TPR_14 [PF13428], Evalue: 0.0098, Aligned region: 42..73
TPR_14 [PF13428], Evalue: 0.0098, Aligned region: 110..137
Protein Sequence: 271 a.a.     [Download]
>gi|148262054|ref|YP_001236181.1| virulence protein, SciE type [Acidiphilium cryptum JF-5]
MADGAAKSDDSGVGALFRAGRLDDAIAAATAKVKSSPSDLSARVLLAELLVFAGNIERADVLLDAAGQLD
PSASIVVAEFRQLLRAETARRQLYRDGRVPEFLGGPGDVETALLAALVALRDGDAEAARRAAETAEAGRG
ARAGTADGSAFADFRDASDICGGIFEVLTTTGKYFWIPISRVTEVTFHPPERPRDLIWRRATLAVHDGPD
GDVYMPVTYAAGDASLAPEFRLGRATDWIEQGGLVTGVGQREFLVGEAAVPVMELGEIVFS
 
Nucleotide Sequence: 816 bp     [Download]
>ref|NC_009484.1|:3356647-3357462 virulence protein, SciE type [Acidiphilium cryptum JF-5]
ATGGCGGATGGCGCAGCAAAGAGCGACGATTCCGGCGTGGGCGCGCTGTTCCGTGCCGGGCGCCTCGATG
ATGCGATCGCGGCCGCAACGGCGAAGGTGAAGTCCAGCCCGTCGGATCTGTCGGCGCGGGTGCTGCTCGC
CGAACTCCTTGTCTTCGCCGGCAATATCGAGCGCGCCGATGTCCTGCTCGATGCCGCGGGCCAGCTTGAC
CCGAGTGCAAGCATCGTTGTTGCCGAATTCCGCCAGCTTCTCCGTGCCGAGACGGCGCGCCGGCAGTTGT
ATCGCGACGGGCGAGTGCCTGAGTTCCTCGGCGGACCGGGCGATGTCGAAACAGCACTTCTGGCGGCCCT
GGTCGCGTTGCGTGACGGCGATGCCGAGGCGGCGAGGCGCGCGGCGGAGACAGCCGAGGCCGGACGCGGC
GCGCGGGCCGGAACTGCCGACGGGAGCGCCTTCGCGGATTTCCGCGATGCCAGCGACATCTGCGGCGGGA
TTTTCGAAGTCCTGACCACGACCGGGAAATATTTCTGGATCCCGATTTCGCGCGTGACGGAGGTGACCTT
TCATCCGCCGGAGCGGCCGCGCGACCTGATCTGGCGGCGCGCGACGCTTGCGGTGCATGACGGGCCCGAT
GGCGACGTCTACATGCCGGTGACCTATGCGGCTGGCGATGCGTCGCTCGCCCCCGAATTCCGGCTCGGAC
GGGCGACGGACTGGATCGAACAGGGCGGCCTTGTGACCGGTGTTGGTCAGCGTGAGTTCCTGGTCGGCGA
GGCGGCCGTGCCCGTAATGGAGCTTGGCGAGATCGTGTTCTCCTGA