SecReT6
Protein ID: 148262055
SecReT6 ID210
T6SS typei5
Gene symbol-
Locus tagAcry_3075
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]3357462..3357983 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA5G331
KEGG IDacr:Acry_3075
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-20, Aligned region: 47..151
Protein Sequence: 173 a.a.     [Download]
>gi|148262055|ref|YP_001236182.1| GPW/gp25 family protein [Acidiphilium cryptum JF-5]
MSGPIGFSDRVRDAGARVQLSLLDRLLDDEPDRDRDRPLSAGEALNMLRRSVRRDLEALLNAKRRWRALP
PALAELRNSIAGYGLPDYTAGSMSATGAREAFRAEVERTIRQFEPRFARVSVTLVKAENPLDPTLYMRIE
GLLHAEPAPEPISFNTVVDSTSAEIEVKGEGGV
 
Nucleotide Sequence: 522 bp     [Download]
>ref|NC_009484.1|:3357462-3357983 GPW/gp25 family protein [Acidiphilium cryptum JF-5]
ATGAGCGGCCCGATCGGCTTCAGCGACCGGGTGCGCGACGCGGGCGCGCGGGTACAACTGTCGCTGCTCG
ACCGATTGCTGGACGATGAACCCGATCGCGATCGGGACCGGCCGCTGTCCGCCGGCGAAGCGCTCAACAT
GCTCCGCCGGTCGGTGCGCCGCGACCTTGAGGCGCTGTTGAATGCGAAGCGCCGCTGGCGTGCATTGCCG
CCGGCGCTGGCAGAGCTGCGCAACTCGATCGCAGGCTACGGACTGCCGGACTATACTGCCGGCAGCATGA
GCGCCACAGGCGCGCGCGAGGCGTTCCGCGCGGAAGTCGAACGCACGATCCGCCAGTTCGAGCCGCGATT
TGCCCGCGTCTCGGTCACGCTCGTCAAGGCCGAGAACCCATTGGACCCCACGCTCTACATGCGGATCGAG
GGGCTGCTGCATGCCGAGCCGGCACCTGAGCCGATCAGTTTCAACACTGTGGTCGACTCAACCTCGGCCG
AGATCGAGGTGAAGGGGGAAGGCGGTGTCTGA