SecReT6
Protein ID: 148262057
SecReT6 ID210
T6SS typei5
Gene symbol-
Locus tagAcry_3077
StrainAcidiphilium cryptum JF-5
Repliconchromosome [GenBank: NC_009484] [Browse all T6SS(s) in this replicon]
Location [Strand]3359790..3360899 [+]
Producthypothetical protein
NoteTssG
UniProt IDA5G333
KEGG IDacr:Acry_3077
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-78, Aligned region: 23..331
Protein Sequence: 369 a.a.     [Download]
>gi|148262057|ref|YP_001236184.1| hypothetical protein Acry_3077 [Acidiphilium cryptum JF-5]
MNRPADSHRRRRTPIGVLDRLTAEPWHFRFGAAVRLLWLASGRSDPGDAIRFTTPLSLGHPAAEIDEAEA
PAPDEPRGRIATRLIGLLGASSPLPRWYTELVAGANRARSPATAAFFDLLSQRIISAFAVAGTKYRPHLA
AEVARHTGAADHGSADPAERALLALTGYGSPDLVGRLTAGRGSILHYAGFFATWPRSASRLEAMLSDWLE
RPVEIIEFAGAWLRIGPDEQSRMPRGRLPGQFNRLGMDCAAGARAYDQQARFVIRIGPLSRAAFAALLPD
RPLLRELVSLVRAYVGMEVDFAVNLVLDPADVPSLRLGGPDAPRLSWTGWLPAPAAAMSGGRKADQAMFA
AGSIEALPALDPALARRAA
 
Nucleotide Sequence: 1110 bp     [Download]
>ref|NC_009484.1|:3359790-3360899 hypothetical protein Acry_3077 [Acidiphilium cryptum JF-5]
GTGAACCGACCGGCGGACAGCCACCGGCGCCGGCGGACGCCAATCGGCGTGCTCGACCGGCTGACTGCCG
AGCCCTGGCACTTTCGTTTCGGCGCTGCGGTCCGGCTGCTTTGGCTGGCCTCGGGGCGAAGCGATCCTGG
CGACGCGATACGCTTCACCACCCCACTGTCCCTCGGCCATCCGGCCGCCGAAATCGATGAGGCCGAGGCG
CCCGCTCCCGACGAGCCGCGAGGCCGGATTGCGACACGGCTCATCGGCCTGCTGGGCGCATCGAGCCCCT
TGCCCCGCTGGTATACTGAACTCGTCGCCGGCGCGAACCGCGCCCGCTCACCGGCGACGGCAGCCTTCTT
CGACCTTCTCTCGCAGCGCATCATCTCGGCTTTCGCGGTCGCCGGAACAAAGTATCGCCCGCATCTTGCC
GCCGAGGTCGCGCGGCACACCGGGGCAGCGGACCATGGGTCGGCCGATCCGGCTGAGCGCGCGCTGCTTG
CGCTGACCGGCTATGGTTCGCCGGACCTGGTCGGCCGGCTGACGGCGGGTCGGGGTTCGATCCTGCATTA
TGCAGGTTTTTTCGCAACCTGGCCGCGTTCGGCCAGCCGGCTTGAGGCGATGCTGAGCGATTGGCTGGAA
CGGCCGGTCGAGATCATCGAATTTGCCGGCGCATGGCTCAGGATCGGGCCTGATGAGCAGAGCCGGATGC
CGCGTGGCAGGCTTCCCGGCCAGTTCAACCGCCTGGGTATGGACTGCGCCGCCGGCGCCAGGGCCTATGA
CCAGCAGGCACGTTTCGTTATCCGCATTGGCCCGCTGTCGCGCGCTGCCTTCGCGGCGCTGCTGCCCGAC
CGGCCGCTGCTGCGCGAGCTTGTGTCGCTGGTGCGGGCGTATGTCGGCATGGAGGTGGATTTTGCCGTGA
ATCTTGTACTGGATCCTGCTGACGTTCCGTCATTACGGCTTGGCGGCCCCGATGCGCCACGCCTGTCCTG
GACCGGGTGGCTGCCCGCACCCGCCGCAGCGATGAGCGGGGGCCGAAAGGCCGATCAGGCGATGTTCGCG
GCCGGATCGATCGAGGCCTTGCCGGCGCTCGACCCCGCTTTGGCGCGGAGAGCCGCATGA