SecReT6
Protein ID: 148547338
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2117
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2396601..2398769 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA5W296
KEGG IDppf:Pput_2117
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.80E-57, Aligned region: 29..349
Phage_base_V [PF04717], Evalue: 1.50E-19, Aligned region: 391..484
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 529..547
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 532..555
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 548..571
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 565..586
Gp5_C [PF06715], Evalue: 1.10E-05, Aligned region: 610..620
Protein Sequence: 722 a.a.     [Download]
>gi|148547338|ref|YP_001267440.1| unnamed protein product [Pseudomonas putida F1]
MPSQSDLRYSFEPLVGNTEFEVVSFKLKEALSQPFTLTLDLVSFEHDVDFGHLLDKPVLFTIWDGGRPVR
YVHGLVSSFSQGESGFYRTYYHVLVEPQLARARLRSNWRIFQHKTVPQILELMLKRQGIDQYELRASLDH
QVREFCVQAGETDLDFIARLTAEEGFVYRFEHSEKRHKLIITDRLQLLGLISHGAIKHEDDAGGFYRERE
PSAPATVLYHSSHGGDQPQPCLRRLRYSEQVRTARQVQRDYTFTHPAYRQEHRASGPYLEHQSTDYECFD
YPGRYKRDAVGKPFTENRITGLRHDVRIAQVQGDDVRLQPGLTFTLTGHPREDLNVHWRVSTVRHEGSQF
TSLQEEAAGADQGTRYEQKAVLVPGRTEWRPAPLPKPRVDGPHMATVVGPPGEEIYCDEWGRVKVSFPWD
RESQDNAFSSCWVRVSQGWAGGSWGSMAIPRIGQDVIIHYVNGDPDQPMITGRTYCGNQLPPYDLPRHKT
RMTIKSQTHKGDGFNELRFEDELGQEEVFIHAQRDQNNVVKHDETTQVGNDRKEQVDHDESILIGHDRTE
TVGNDEHITIGQDAALDIGRNHTIRIAKDRVENIGNHRHDQIAANHHTRIGGNFEQRVEGHAELEARGDI
RRRTRRYELRASEAVVIQGPGGSIRIDETGITLDSPTIRITGQMLKSANGTTSPFSISSAPNTGKPLERL
CGRRPDGTCPLPDCRCIRGPGQ
 
Nucleotide Sequence: 2169 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2398769-2396601 Pseudomonas putida F1 chromosome, complete genome
ATGCCTAGCCAATCTGATTTACGCTACAGCTTTGAACCACTCGTGGGCAACACTGAGTTCGAAGTGGTGT
CGTTCAAGCTCAAGGAGGCGCTCAGCCAACCGTTCACGTTGACCCTGGACCTCGTCAGCTTCGAACACGA
TGTCGACTTCGGCCACCTGCTCGACAAACCCGTGCTGTTCACCATCTGGGACGGTGGCCGCCCCGTACGC
TACGTACATGGCCTGGTCAGCAGCTTCAGCCAGGGCGAGAGTGGCTTCTACCGCACTTACTACCACGTAT
TGGTCGAACCGCAACTGGCCCGCGCCAGGCTGCGCTCGAACTGGCGCATCTTCCAGCACAAGACCGTGCC
GCAAATTCTTGAACTGATGCTCAAGCGCCAGGGCATCGACCAGTACGAACTACGCGCCAGCCTGGACCAC
CAAGTGCGCGAATTCTGCGTACAAGCCGGCGAAACCGACCTCGACTTCATCGCCCGCCTGACAGCCGAAG
AAGGCTTCGTCTACCGCTTCGAGCACAGTGAGAAACGCCATAAGCTGATCATCACCGACAGACTGCAGTT
ACTCGGTCTGATAAGTCACGGTGCCATCAAACACGAGGACGACGCCGGAGGCTTCTACCGTGAGCGTGAA
CCGTCAGCCCCAGCCACCGTGCTGTACCATTCCAGCCACGGCGGCGACCAGCCTCAACCGTGCCTACGGC
GCTTGCGCTACAGCGAACAGGTGCGTACTGCACGGCAGGTTCAACGCGACTACACCTTCACCCACCCGGC
CTATCGTCAGGAACACAGGGCCTCGGGCCCGTATCTTGAGCACCAGTCCACGGACTATGAGTGCTTCGAC
TACCCCGGCCGTTACAAACGCGATGCCGTTGGCAAGCCGTTCACCGAAAACCGCATCACCGGCTTGCGCC
ATGACGTGCGTATTGCCCAAGTGCAAGGCGACGATGTGCGCTTGCAACCAGGCCTGACCTTCACCCTGAC
AGGCCACCCGCGCGAAGACCTGAATGTGCATTGGCGGGTCAGCACGGTTCGCCACGAAGGCAGCCAGTTC
ACCAGCCTGCAGGAAGAAGCTGCCGGGGCCGACCAGGGCACACGTTACGAGCAAAAGGCGGTACTGGTGC
CAGGCAGAACCGAATGGCGCCCAGCCCCGTTGCCCAAACCACGCGTTGACGGCCCGCACATGGCCACCGT
GGTGGGGCCGCCCGGTGAAGAGATCTACTGCGACGAATGGGGCCGGGTCAAGGTCAGCTTCCCCTGGGAC
AGAGAAAGCCAGGACAACGCGTTCAGTTCCTGCTGGGTACGCGTATCCCAAGGCTGGGCCGGCGGCAGCT
GGGGCTCGATGGCCATCCCACGGATTGGCCAGGACGTGATCATCCACTACGTCAACGGCGACCCCGACCA
GCCGATGATCACCGGCCGTACTTACTGCGGTAACCAGCTGCCACCGTACGACCTTCCCCGTCACAAGACC
CGCATGACCATCAAGAGCCAGACCCACAAGGGCGATGGCTTCAACGAGCTGCGCTTCGAGGACGAACTGG
GCCAGGAGGAAGTGTTCATTCATGCCCAGAGGGACCAGAACAATGTGGTCAAGCACGATGAGACTACGCA
GGTCGGCAATGACCGCAAAGAGCAGGTCGATCACGACGAATCGATCCTGATCGGCCACGACCGTACGGAA
ACGGTTGGCAATGACGAGCACATCACCATCGGGCAGGACGCCGCGCTCGACATCGGCAGAAACCACACGA
TCAGGATCGCCAAGGACCGTGTCGAAAACATCGGCAATCACCGTCACGACCAGATCGCCGCCAATCACCA
CACCCGTATCGGTGGCAACTTCGAACAACGGGTCGAAGGGCATGCCGAGCTGGAAGCCCGTGGGGATATC
CGCAGACGTACTCGCCGTTATGAACTTCGAGCCTCGGAAGCCGTGGTCATCCAAGGCCCTGGTGGCTCCA
TTCGAATCGACGAAACGGGCATCACCCTGGACAGCCCGACGATTCGCATCACCGGCCAGATGCTCAAGTC
GGCAAATGGGACGACAAGCCCCTTTTCCATCAGCAGTGCACCGAACACCGGCAAGCCTCTGGAGCGCTTG
TGTGGGCGCCGCCCTGATGGTACCTGCCCCCTGCCCGATTGCCGCTGTATCCGAGGGCCAGGCCAATGA