SecReT6
Protein ID: 148547340
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2119
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2399491..2400360 [-]
Producthypothetical protein
NoteTssL
UniProt IDA5W298
KEGG IDppf:Pput_2119
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-64, Aligned region: 67..272
Protein Sequence: 289 a.a.     [Download]
>gi|148547340|ref|YP_001267442.1| unnamed protein product [Pseudomonas putida F1]
MGKDNNTPTDENNAAVNALDSTLEQPVPAPRAAATNAQVSTDKPEPEPVSEGYPADPEFQLRGGFANLML
DAASPLFGLVIRLRTLDELPNIQDVHQQVRGQIDNIQEELRQHGYEPAQLLAYSYGLCLFIDEAVMERPW
GKSSCWSQEPLLSIFHDETWGGEKIFTVITRLMQEPKRYQDVLEFMYYALCLGLKGKYALAPKGEETLNA
LIHQLHGIIRELRGPTPEEVCDPYTNVAPRNFRMNRQWPWWSPLVISAIAMAVAYSIYSYRLHLITTEVL
ESLNGILQQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2400360-2399491 Pseudomonas putida F1 chromosome, complete genome
ATGGGAAAAGACAACAATACGCCCACCGATGAAAACAACGCTGCAGTCAACGCGCTTGATTCAACCCTTG
AACAGCCAGTACCCGCCCCCCGGGCTGCGGCAACCAATGCGCAAGTATCCACGGACAAACCTGAGCCTGA
GCCCGTTTCCGAAGGCTACCCCGCTGACCCGGAATTTCAGCTGCGGGGCGGCTTCGCCAACCTGATGCTG
GATGCCGCATCGCCGTTGTTCGGCTTGGTTATACGCCTGCGTACGCTGGACGAGCTGCCAAACATCCAGG
ACGTGCACCAGCAAGTGCGCGGCCAGATCGACAACATCCAGGAAGAACTGCGCCAGCACGGTTACGAGCC
GGCTCAGTTGCTGGCGTACTCCTACGGTCTGTGCCTGTTCATAGACGAGGCCGTTATGGAGCGCCCCTGG
GGCAAGAGCAGCTGCTGGAGCCAGGAGCCGCTGCTCAGCATCTTCCACGACGAGACCTGGGGTGGGGAAA
AAATCTTCACGGTGATTACCCGCCTGATGCAGGAGCCCAAGCGTTACCAGGACGTACTGGAGTTCATGTA
CTACGCCCTGTGCCTTGGGCTGAAGGGCAAGTACGCGCTCGCGCCGAAAGGCGAAGAAACACTCAACGCA
TTGATTCACCAACTGCACGGGATCATCCGCGAACTGCGCGGCCCTACCCCCGAAGAAGTCTGCGACCCCT
ACACCAATGTGGCCCCACGCAACTTCCGCATGAACCGGCAATGGCCCTGGTGGAGCCCCTTGGTGATTTC
CGCCATCGCCATGGCGGTGGCTTACAGCATCTACAGCTATCGCCTGCACCTGATTACCACCGAAGTGCTG
GAGTCGCTGAACGGCATTTTGCAGCAATAG