SecReT6
Protein ID: 148547342
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2121
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2401755..2402552 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA5W2A0
KEGG IDppf:Pput_2121
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-24, Aligned region: 17..64
T6SS-SciN [PF12790], Evalue: 1.80E-24, Aligned region: 156..256
Protein Sequence: 265 a.a.     [Download]
>gi|148547342|ref|YP_001267444.1| unnamed protein product [Pseudomonas putida F1]
MKPHPLLLATLLLALVVPTGCTSLSRMSQVAMDHSLPIGPPKDHPTEVAFSINASPTLNGNPNSLDVAAE
QDSALEPSPYAVTLSAGDPYALTEKIGVLFEYLQAQFPAMSPVELDEGDESDPARSPQEESGPGSYDDPQ
VALTLPRTTSVASALVATPINITILQLRDDSLLRNTVYQLLEQDPAKALRSTYIRSDDYLLRPGQFKYIP
FEPIHAETRFVAVIADYRGHENASWRQVLRIPPRGRQIMLSVLVNDTHIVLKEED
 
Nucleotide Sequence: 798 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2402552-2401755 Pseudomonas putida F1 chromosome, complete genome
ATGAAACCTCATCCACTTCTGCTCGCCACCCTGTTGCTTGCGCTGGTCGTGCCCACCGGCTGTACCTCTT
TGAGCAGAATGAGCCAGGTGGCCATGGACCACTCGTTGCCCATCGGGCCGCCCAAGGATCACCCGACCGA
GGTCGCATTCAGCATCAATGCCAGCCCTACCCTCAACGGCAATCCGAACAGCCTTGACGTCGCAGCCGAA
CAGGATAGCGCCCTGGAGCCCAGCCCCTACGCTGTAACCCTGAGTGCTGGCGACCCCTATGCGTTGACCG
AAAAAATCGGGGTTCTGTTCGAATACCTGCAAGCGCAATTCCCGGCCATGTCCCCCGTCGAGCTGGACGA
AGGAGACGAAAGCGACCCGGCGCGCTCACCCCAGGAAGAAAGCGGCCCCGGCAGCTACGACGACCCTCAG
GTGGCGTTGACCTTGCCGCGCACCACAAGCGTTGCCTCAGCGCTGGTCGCTACGCCCATTAACATCACGA
TCCTGCAACTGCGCGATGACTCACTGCTGCGCAACACCGTGTACCAGCTACTGGAGCAGGACCCGGCCAA
GGCGCTGCGCAGTACCTACATCCGCAGTGACGATTACCTGCTGCGCCCTGGCCAGTTCAAGTACATCCCG
TTCGAGCCTATCCACGCCGAAACCCGCTTCGTCGCGGTGATTGCCGATTACCGAGGGCATGAAAACGCCA
GTTGGCGGCAAGTTCTGCGCATTCCGCCGCGTGGCCGCCAGATCATGCTGTCGGTGCTGGTCAACGACAC
GCACATCGTGCTCAAGGAAGAAGACTGA