SecReT6
Protein ID: 148547343
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2122
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2402549..2403118 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDA5W2A1
KEGG IDppf:Pput_2122
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 7.30E-09, Aligned region: 30..96
Protein Sequence: 189 a.a.     [Download]
>gi|148547343|ref|YP_001267445.1| unnamed protein product [Pseudomonas putida F1]
MNTVTLSITNLDQLQHGVTARHLFDCKGGTIGSGRANWQINDRDQTVAPIHCEIRWIEGSFCVIDHCHRT
YLNGSANSLGPLPPRRLVEGDQLLIGTYRLQVQYTQDQACTRSLEDLFNPDPRVLDRLIAEAPAPAWPAQ
PSAPQPAVEICSVFKAAMGNDPLAALDAADGEGALRESPLQRLIAGAYP
 
Nucleotide Sequence: 570 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2403118-2402549 Pseudomonas putida F1 chromosome, complete genome
ATGAACACAGTCACCTTGAGCATCACCAACCTCGACCAACTGCAGCACGGCGTTACTGCTCGGCACCTGT
TCGATTGCAAGGGCGGCACCATCGGCAGCGGGCGAGCAAACTGGCAGATCAATGACCGCGATCAGACCGT
TGCGCCCATCCACTGCGAAATCCGCTGGATCGAAGGCAGCTTCTGTGTGATCGACCACTGCCACCGTACC
TACCTCAATGGCAGTGCCAACAGCCTGGGGCCGCTTCCACCCAGACGCCTGGTTGAGGGTGACCAGCTTC
TCATTGGTACCTATCGGCTACAGGTTCAGTACACCCAGGATCAGGCCTGCACGCGCTCGCTGGAGGACCT
GTTCAACCCGGACCCGAGGGTGCTCGACCGCCTGATAGCGGAAGCGCCTGCACCCGCTTGGCCGGCACAG
CCTTCTGCCCCCCAACCAGCCGTCGAGATCTGCTCGGTCTTCAAAGCAGCCATGGGGAATGACCCTCTGG
CAGCGCTGGACGCAGCAGACGGTGAAGGGGCGCTCCGAGAAAGCCCGCTGCAGCGCCTGATTGCCGGAGC
ATACCCATGA