SecReT6
Protein ID: 148547344
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2123
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2403115..2404131 [-]
Producthypothetical protein
NoteTssG
UniProt IDA5W2A2
KEGG IDppf:Pput_2123
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.10E-86, Aligned region: 19..321
Protein Sequence: 338 a.a.     [Download]
>gi|148547344|ref|YP_001267446.1| unnamed protein product [Pseudomonas putida F1]
MANTDRQATADLADKLLCEAHQYNFFQLLERLHGLHGDDLEPRWPDKATRRRVRLACDPRLTFPVSDVYK
AQRMPAEEARYRIVATFLGLHGTDSPLPTYYLEQVAYEHAHGIGVRPAFFDFFNHYLLSLLHRIWRKYRY
YIRFQPGASDGFSQYVFALLGLNDKQLRGDTALPWSRLLSFAGVIASRSRAPGTVAGIIAHCFDLNQVHI
REFETRSVVTPSRQLARLGRTNGQLGSTFMIGSRTRTRSSKFTIVISELDQTQLRDLLPSGINFGRLRAL
IDFLLRDGLAYDLELRLKPSALSPFCLHRSQGAYLGWTSFVDDRHGQISPVVRIRGRS
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2404131-2403115 Pseudomonas putida F1 chromosome, complete genome
ATGGCCAATACAGACCGGCAAGCAACCGCTGATCTAGCCGACAAGCTGCTTTGCGAAGCGCACCAGTACA
ACTTCTTCCAGTTGCTGGAGCGGTTGCACGGGCTGCATGGCGATGACCTGGAACCCCGTTGGCCGGACAA
GGCCACCCGGCGGCGCGTGCGCCTGGCCTGCGACCCACGGCTGACCTTCCCTGTATCGGACGTGTACAAA
GCCCAGCGAATGCCCGCTGAGGAAGCGCGCTACCGTATCGTTGCCACGTTCCTGGGGTTGCACGGCACCG
ATTCGCCATTGCCCACCTATTACCTGGAACAGGTGGCGTATGAACATGCGCATGGCATCGGTGTACGCCC
GGCCTTCTTCGACTTCTTCAACCACTACCTGCTCAGCCTGTTGCACCGTATCTGGCGCAAGTACCGCTAT
TACATCCGCTTCCAGCCAGGTGCCAGTGACGGGTTCTCGCAGTACGTGTTTGCCCTGCTTGGGCTTAACG
ACAAGCAGTTACGAGGGGACACGGCGCTGCCCTGGAGCCGCCTGCTCAGTTTTGCCGGCGTGATCGCCAG
CCGCAGCCGTGCGCCGGGCACTGTGGCCGGCATCATTGCGCACTGCTTCGACCTCAATCAGGTGCACATC
CGCGAGTTCGAGACGCGATCAGTCGTCACGCCGTCCAGGCAGCTTGCAAGGCTGGGGCGGACCAATGGCC
AGCTGGGCAGCACGTTCATGATTGGCAGCCGCACGCGCACTCGCAGCAGCAAGTTCACCATCGTGATCAG
CGAACTCGACCAGACACAGCTGCGGGACTTGCTGCCCAGCGGCATCAACTTCGGCCGTTTGCGTGCACTG
ATCGACTTTCTGCTGCGTGACGGGCTGGCCTACGACCTGGAACTGCGCCTTAAGCCGAGCGCGTTGTCCC
CCTTCTGCTTGCACCGCAGCCAGGGCGCATACCTGGGCTGGACCAGCTTCGTCGATGACCGGCATGGCCA
GATCAGCCCGGTTGTACGCATCCGGGGGCGCTCATGA