SecReT6
Protein ID: 148547345
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2124
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2404095..2405861 [-]
Producthypothetical protein
NoteTssF
UniProt IDA5W2A3
KEGG IDppf:Pput_2124
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.50E-192, Aligned region: 4..588
Protein Sequence: 588 a.a.     [Download]
>gi|148547345|ref|YP_001267447.1| unnamed protein product [Pseudomonas putida F1]
MSLRDRFSEELRYLNELGNDFAKDNPQLARLLGKGASDPDVERLMEAFALLTAKLRLKLEDDLPELTHPM
LQLLWPNYLRPLPSATIIKFSPVRQSLSQSQRIPKGSRLFSKPVDGVACEFRTCTAVNIHPFEIDTVAAT
QTSDSSVICIGLQSLAERPLNSLGCTSLDFYLSGDARTARTLYLWVSQYLKHVSVSINDVVRRLPANSIA
FPGFSPNDALLPYPQNVFDGYRILQEYFAFPQRFHFFSVTGLEKIWPAHGSQQVNLEFHFTRQLPDSLRV
GKADFHLFCAPAVNLFQHSAEPIDLSGKDAMVPLKPKGTAPHGYEIFSVDQVISTRTTTDGNTGEHLRTF
RPFESFAHEIEHVQGRTALYYRCQLEECLHGNGVMHRIAFVRADANSYIGELETASIDLTCTNRDLPLAL
GIDDINILTELTPPLATYTNLCTPTRPCRPVLDGQLQWALISNMSLNYLSLLSVEPLKAVIRAYDFMALH
DIQQARTTRKRLEGIRDIHTQPMDWLIKGQPIRGLHTRLKLDQTAFLCEGDLYLFSCVLAHFFALYASIN
SFHQLEVINTTNNEHYTWPIQTGKQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2405861-2404095 Pseudomonas putida F1 chromosome, complete genome
ATGTCACTGAGAGACCGTTTCAGCGAAGAACTGCGTTACCTGAACGAACTGGGGAACGACTTTGCCAAGG
ACAACCCACAACTCGCGCGGTTGCTTGGCAAAGGTGCCAGCGACCCCGATGTCGAACGCCTGATGGAAGC
CTTTGCGCTCCTGACCGCCAAGCTACGGCTGAAGCTGGAAGACGACTTGCCAGAGCTGACCCATCCCATG
CTGCAGTTGCTCTGGCCGAACTACCTGCGGCCGCTGCCCAGCGCGACGATCATCAAGTTCAGCCCGGTGA
GGCAATCCCTCAGCCAGTCACAGCGCATCCCAAAGGGGTCGCGGCTGTTCTCGAAACCGGTAGACGGCGT
GGCCTGCGAGTTCCGCACCTGTACAGCGGTCAACATTCATCCGTTCGAGATCGACACGGTGGCAGCCACC
CAGACATCCGACAGTTCCGTGATCTGCATCGGCCTTCAATCACTGGCCGAGCGGCCGTTGAACAGCCTGG
GCTGTACCAGCCTCGACTTTTACCTCAGCGGCGATGCCCGAACCGCTCGCACGCTTTACCTGTGGGTTTC
CCAATACCTCAAGCATGTCAGCGTGAGCATCAATGACGTGGTTCGTCGGCTGCCGGCAAACAGCATCGCA
TTCCCAGGGTTCAGCCCCAACGACGCCTTGCTGCCTTATCCACAGAACGTCTTTGATGGCTACCGCATCC
TGCAGGAATACTTCGCGTTCCCTCAACGTTTTCACTTTTTCAGCGTTACCGGGCTGGAAAAAATCTGGCC
AGCTCATGGCAGCCAGCAGGTAAACCTCGAATTTCACTTCACGCGCCAGCTACCCGACTCGCTGCGTGTC
GGCAAAGCAGATTTCCACCTGTTCTGCGCACCTGCGGTCAACCTGTTCCAGCACAGCGCCGAGCCCATCG
ACCTGTCCGGCAAGGACGCCATGGTTCCACTGAAGCCCAAGGGCACAGCGCCGCACGGCTACGAAATCTT
CAGTGTCGACCAGGTGATCAGCACCCGAACGACGACTGACGGGAACACCGGTGAGCACCTTCGGACCTTC
CGTCCCTTCGAGTCATTCGCCCATGAAATCGAGCACGTCCAGGGGCGCACGGCGCTGTATTACCGCTGCC
AGCTGGAAGAGTGCCTGCACGGCAATGGCGTCATGCATCGAATCGCCTTCGTCCGCGCCGACGCCAACAG
CTACATAGGCGAGCTGGAAACCGCGTCCATCGACCTCACCTGCACCAATCGGGACCTCCCGCTGGCGCTG
GGCATTGATGACATCAACATTCTGACCGAACTTACGCCGCCTCTGGCCACCTACACCAATCTCTGTACAC
CCACCCGCCCCTGTCGCCCGGTGCTGGACGGCCAGTTGCAGTGGGCATTGATCTCCAACATGTCGCTCAA
CTACCTGTCCTTGCTCTCGGTAGAGCCGCTGAAAGCGGTGATCCGCGCCTACGACTTCATGGCCCTGCAC
GACATCCAGCAGGCCCGCACCACCCGTAAACGCCTGGAAGGTATACGCGACATTCATACGCAGCCCATGG
ATTGGCTGATCAAGGGGCAACCCATTCGCGGCCTGCACACCCGGCTGAAACTGGACCAGACCGCCTTCCT
CTGCGAAGGCGACTTGTACCTGTTCAGCTGTGTGCTCGCTCATTTTTTCGCCCTGTACGCCAGCATCAAT
TCCTTCCACCAGCTGGAAGTGATCAACACCACCAATAACGAGCACTACACATGGCCAATACAGACCGGCA
AGCAACCGCTGATCTAG