SecReT6
Protein ID: 148547346
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2125
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2405865..2406275 [-]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDA5W2A4
KEGG IDppf:Pput_2125
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-20, Aligned region: 25..119
XLF [PF09302], Evalue: 0.003, Aligned region: 6..90
Protein Sequence: 136 a.a.     [Download]
>gi|148547346|ref|YP_001267448.1| unnamed protein product [Pseudomonas putida F1]
MSGLFDRLMVDQCTRREASRRESASHKFAAIKRHLETLLNARQGCSQSSPELGLRDFNGHDVSNGDLLVQ
VSADIRRTLQRFEPRIQVRTLNAVPDTLAPLELHFRLDCLVQVNNHAEQLQLELLVDGHNRYTRVR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2406275-2405865 Pseudomonas putida F1 chromosome, complete genome
ATGAGTGGTCTTTTTGATCGCCTGATGGTGGACCAGTGCACCCGCCGGGAGGCCTCCCGACGCGAGAGCG
CTTCCCACAAGTTCGCCGCCATCAAGCGCCACCTCGAAACGCTACTGAATGCCCGCCAGGGGTGCTCCCA
GAGCAGCCCTGAGCTGGGCCTGCGCGACTTCAACGGGCATGACGTGAGCAACGGCGACTTGCTTGTGCAG
GTGAGCGCGGATATCCGCCGCACACTCCAGCGCTTCGAGCCGCGCATACAGGTACGCACGCTCAACGCAG
TGCCCGATACCCTTGCCCCGCTGGAGCTGCATTTCAGGCTGGATTGCCTGGTACAGGTCAACAACCACGC
AGAGCAGCTGCAACTCGAGCTGCTGGTCGATGGGCACAACCGCTACACGCGCGTGAGGTGA