SecReT6
Protein ID: 148547347
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2126
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2406272..2407762 [-]
Producthypothetical protein
NoteTssC
UniProt IDA5W2A5
KEGG IDppf:Pput_2126
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-184, Aligned region: 70..494
Protein Sequence: 496 a.a.     [Download]
>gi|148547347|ref|YP_001267449.1| unnamed protein product [Pseudomonas putida F1]
MPKPSSTAITTDATADTLSNATLLDQIMAETKLVPAQEGYQIARQGVSAFITEILKSNDPDQLINKHRAD
QMIAEIDRMLGNQMDAILHQPEFQQLESSWRSLKLLVDRTDFRENIKLEVLHVTKEDLLDDFENAADITC
SGIYKHVYTAGYGQFGGEPVAAMVGNYNFGPSSPDIKLLSYMASVGAMSHAPFLAAPAPEFFNLNSFEEL
PNLKEIKDLFAGPRHAKWRAFRESEDARHVALTGPRFMLRSAYHPQEQPIESFNYNEDIAGQHDNYLWGN
SAFLLASCINDSFARYRWCPNIIGPQSGGAVEDLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIA
LTMRKDSDNAAFFSANSVQKPKHFPKTPEGLQAQTNYKLGTQLPYLFIVNRLAHYIKVLQREQIGSWKER
RDLESELNKWIKQYVADQENPSADVRSRRPLRAARIEVSDVAGDPGWYQVSLAVRPHFKYMGANFEISLV
GRLDTQ
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2407762-2406272 Pseudomonas putida F1 chromosome, complete genome
ATGCCCAAGCCAAGCAGCACCGCCATCACCACAGACGCAACGGCCGACACATTGAGCAATGCCACCCTGC
TCGACCAGATCATGGCAGAAACCAAACTGGTACCTGCCCAGGAGGGCTACCAGATTGCCAGGCAGGGCGT
ATCTGCCTTCATCACCGAAATACTCAAAAGCAATGACCCAGATCAACTGATCAACAAGCACCGAGCCGAC
CAGATGATTGCCGAGATCGACCGAATGCTCGGCAATCAGATGGATGCCATTCTGCATCAGCCTGAGTTCC
AGCAGCTTGAATCATCATGGCGCAGCCTTAAACTTCTGGTCGACCGCACGGACTTCAGGGAGAACATCAA
GCTTGAAGTCTTGCATGTCACGAAAGAGGACCTGCTCGACGACTTCGAAAATGCTGCTGACATTACCTGC
AGCGGTATCTACAAGCATGTTTACACCGCGGGTTATGGCCAATTCGGGGGAGAGCCGGTTGCGGCCATGG
TAGGCAACTACAACTTCGGCCCCTCTTCCCCTGACATCAAGTTGCTAAGTTACATGGCCTCCGTTGGCGC
CATGTCCCATGCCCCTTTTCTTGCTGCTCCTGCCCCCGAATTCTTCAATTTGAACAGCTTCGAGGAGCTG
CCTAACCTCAAGGAAATAAAAGACCTCTTCGCCGGCCCTCGGCATGCCAAGTGGCGCGCTTTTCGTGAAA
GCGAAGACGCCCGCCACGTCGCCCTGACCGGGCCGCGCTTCATGCTTCGCTCCGCTTACCACCCGCAGGA
ACAACCGATCGAGAGCTTCAACTACAACGAAGACATCGCCGGGCAGCACGACAACTACCTGTGGGGCAAT
TCTGCTTTTCTGTTAGCCAGTTGCATCAACGACAGCTTCGCCCGCTACCGCTGGTGCCCGAACATCATCG
GCCCCCAATCCGGCGGTGCTGTCGAAGACTTGCCGGTCCACCTGTACGAATCCCTGGGCCAGTTGCAGGC
CAAGATTCCTACCGAGGTGCTGATATCCGACCGCAAGGAATTCGAACTGGCCGAAGAGGGCTTCATCGCC
CTGACCATGCGCAAAGACAGCGACAACGCCGCGTTCTTCTCCGCCAACTCGGTACAAAAGCCCAAGCACT
TCCCGAAAACCCCTGAGGGGCTTCAGGCACAGACCAACTACAAGCTGGGTACCCAGTTGCCCTACCTGTT
CATCGTCAACCGGCTCGCCCACTACATCAAGGTGCTGCAGCGCGAGCAGATCGGCAGTTGGAAAGAGCGC
CGTGACCTTGAGTCCGAGCTGAACAAATGGATCAAGCAGTACGTCGCCGACCAGGAGAACCCGTCTGCCG
ACGTTCGCAGCCGCCGGCCGCTGCGTGCCGCCCGTATTGAGGTCTCGGATGTTGCGGGTGACCCGGGCTG
GTACCAGGTTTCGCTCGCCGTACGTCCGCACTTCAAGTACATGGGCGCGAACTTCGAGATTTCCCTGGTC
GGGCGGCTCGATACGCAATGA