SecReT6
Protein ID: 148547348
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2127
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2407780..2408283 [-]
Producthypothetical protein
NoteTssB
UniProt IDA5W2A6
KEGG IDppf:Pput_2127
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-54, Aligned region: 6..158
Protein Sequence: 167 a.a.     [Download]
>gi|148547348|ref|YP_001267450.1| unnamed protein product [Pseudomonas putida F1]
MSKNTGSVAPKERVNIKYVPATSDEQAEVELPHKMLVLGDFGLDDSRALEDRQVMRIDKHTFNSVLNDAN
VSLDVTVPSRLRTAPDTELAVHLQFRSINDFGPDRIARQVPELNKLLALREALVALKGPLGNVPAFRKQL
QHLLNNEQARKQLAQELDLVLEAPEKD
 
Nucleotide Sequence: 504 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2408283-2407780 Pseudomonas putida F1 chromosome, complete genome
ATGTCTAAAAATACGGGATCCGTTGCGCCGAAAGAACGCGTCAATATCAAGTATGTGCCCGCTACCAGCG
ATGAGCAGGCCGAGGTGGAGCTACCGCACAAGATGCTGGTGCTGGGCGACTTCGGCCTGGATGACAGCCG
TGCGCTTGAGGACCGTCAGGTCATGCGCATCGATAAACATACATTCAACAGCGTGTTGAACGACGCCAAC
GTAAGCCTGGACGTAACGGTACCGTCCAGGCTTCGCACCGCCCCGGATACCGAGCTGGCCGTCCACCTGC
AGTTCAGGTCCATCAACGATTTCGGGCCGGACCGGATCGCGCGCCAGGTGCCCGAGCTGAACAAGCTGCT
GGCGCTGCGCGAAGCACTGGTCGCCCTGAAAGGCCCGCTGGGCAACGTCCCGGCCTTCCGCAAGCAATTG
CAGCACCTGCTTAACAACGAGCAGGCGCGTAAGCAGCTCGCCCAAGAACTGGACCTGGTGCTCGAGGCGC
CAGAAAAAGATTGA