SecReT6
Protein ID: 148547350
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2129
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2409249..2410712 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA5W2A8
KEGG IDppf:Pput_2129
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-18, Aligned region: 54..114
Protein Sequence: 487 a.a.     [Download]
>gi|148547350|ref|YP_001267452.1| unnamed protein product [Pseudomonas putida F1]
MSVVAQVSGEEVTRLLAPIDPAVPAGLFDVEDETYQAIDQEMVKLGGLQEASIDWVYIEDASRQYLSQQC
KHLRIVAHLSTAWLRSGCWEQWGCTLALLAGMLECYWEAAHPKPGPKGFLGKRKLVALVIDRLAEALPRL
DRFTYTPTHAAAAQAALKRLQQQETVQLDTAALGELERLLGKYSELANGVGEAAVPKAPAATEKPAPLAD
VIATPVSRMSMGNERETRRAVLSMAELINQQDPYDATGYQLRRFGLWAHIQVAPQVRQGNRTELMAVPLD
ITRVYDEAIASKAVDPALLQRIEKSLTACPFWIRGSFLAATVATQLAMCEVAEAIRCATARFVQRMPSLQ
QLCFSDGLVFVDDQCLAWLKGTQGPSGQGATPQEFSGLREELVSQLETGGVEPLLLRLQGLQAGFRAPRE
RCHTTVIAADLLAARGVSWLAQDLCANVARTMQQTTASAWEPEVFQRLQQYAASPVLAVQDKDQEPR
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|148545259|ref|NC_009512.1|:2409249-2410712 Pseudomonas putida F1 chromosome, complete genome
ATGTCGGTGGTAGCGCAGGTATCCGGGGAAGAGGTCACTCGGTTGCTCGCGCCGATTGATCCGGCAGTTC
CGGCTGGCCTGTTCGATGTCGAGGACGAAACCTATCAGGCCATTGATCAGGAGATGGTCAAGCTGGGTGG
GCTGCAGGAAGCCTCGATCGACTGGGTCTACATCGAAGACGCGTCCCGTCAGTACCTGAGCCAGCAATGC
AAGCACTTGCGAATTGTTGCGCACCTGAGTACCGCATGGTTGCGTAGCGGCTGCTGGGAGCAGTGGGGAT
GCACCTTGGCGTTGCTGGCCGGCATGCTCGAGTGCTATTGGGAAGCCGCTCATCCCAAGCCGGGACCGAA
AGGCTTCCTGGGCAAGCGCAAGCTGGTTGCCCTGGTGATCGATCGCTTGGCCGAGGCGCTCCCTCGTCTT
GATCGTTTTACCTACACCCCGACCCACGCAGCGGCAGCGCAGGCTGCCTTGAAACGCCTGCAGCAACAGG
AAACAGTGCAGCTGGACACGGCAGCACTGGGCGAACTTGAGCGCCTGCTAGGCAAGTACTCGGAACTTGC
CAACGGTGTTGGCGAGGCTGCTGTGCCCAAAGCGCCGGCTGCAACCGAGAAGCCTGCGCCGTTGGCCGAT
GTCATCGCCACACCCGTGTCACGCATGTCGATGGGCAATGAGCGTGAGACACGGCGGGCCGTGCTGTCCA
TGGCCGAGCTCATCAACCAGCAGGACCCTTACGACGCTACCGGCTATCAGTTACGGCGTTTCGGTTTGTG
GGCGCACATTCAGGTTGCTCCCCAAGTCAGGCAGGGCAACCGTACGGAATTGATGGCGGTGCCGCTGGAT
ATCACGCGGGTCTATGACGAGGCCATTGCCAGTAAGGCGGTTGACCCCGCCTTGCTGCAGCGTATTGAAA
AGAGCCTGACGGCTTGCCCCTTCTGGATTCGTGGCAGCTTTCTGGCTGCGACCGTCGCCACACAGCTGGC
GATGTGCGAGGTGGCCGAAGCCATCCGCTGTGCCACCGCCCGGTTTGTACAGCGCATGCCGTCGCTGCAG
CAGTTGTGCTTCAGCGATGGGCTGGTATTTGTCGACGATCAGTGCCTGGCCTGGCTTAAGGGCACGCAAG
GGCCGTCTGGCCAAGGTGCAACCCCCCAGGAGTTCAGCGGCCTGCGCGAGGAGTTGGTCAGCCAGCTGGA
AACCGGTGGCGTAGAACCGCTGCTCCTTCGGCTGCAAGGGCTGCAAGCGGGCTTTCGTGCTCCCCGTGAG
CGCTGCCACACCACCGTGATTGCAGCTGATCTGCTGGCCGCGCGGGGTGTGTCCTGGCTGGCCCAGGACC
TGTGCGCCAACGTTGCCCGAACCATGCAGCAAACCACCGCCAGTGCGTGGGAGCCCGAGGTGTTTCAGCG
GCTTCAGCAGTACGCGGCATCCCCAGTGTTGGCAGTTCAAGACAAGGATCAGGAGCCTCGATGA