SecReT6
Protein ID: 148547352
SecReT6 ID211
T6SS typei1
Gene symbol-
Locus tagPput_2131
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2414407..2416260 [-]
ProductABC transporter-like protein
NoteTagT
UniProt IDA5W2B0
KEGG IDppf:Pput_2131
PDB IDNA
Domain hit(s) vs Pfam ABC_tran [PF00005], Evalue: 4.70E-36, Aligned region: 377..531
ABC_membrane [PF00664], Evalue: 6.60E-15, Aligned region: 56..302
SMC_N [PF02463], Evalue: 6.80E-08, Aligned region: 406..573
DUF258 [PF03193], Evalue: 1.00E-05, Aligned region: 372..421
MMR_HSR1 [PF01926], Evalue: 0.00011, Aligned region: 389..432
AAA_21 [PF13304], Evalue: 0.00066, Aligned region: 391..415
AAA_21 [PF13304], Evalue: 0.00066, Aligned region: 503..537
AAA_16 [PF13191], Evalue: 0.0015, Aligned region: 390..538
AAA_29 [PF13555], Evalue: 0.0038, Aligned region: 382..404
AAA_22 [PF13401], Evalue: 0.0092, Aligned region: 392..473
Protein Sequence: 617 a.a.     [Download]
>gi|148547352|ref|YP_001267454.1| unnamed protein product [Pseudomonas putida F1]
MLRIFERRLDPFPPDEVPPPPVGLLRFMWACTRGARGYILALALLSAGVSIYEAWLFAFLGQVVDLLASW
QAGGTVGPEESRVLWGIGIVLLVSIGLVALRTMVQHQVLAINLPLRLRWDFHRLMLRQSLSFFSDEFSGR
VTTKVMQTALAVRDVLFTLIEILPGIGVYFIAIIALAGGFALKLMLPFIAWVVLFGLAMLYFVPRLGKVG
QEQANARSSMTGRVSDAYTNITTVKLFSHSNREAHFARAAMEDFKQTGFRQMRLVSQFEIVNQALVVGLI
FGAGGYALWLWHQGQVGTGAVAAITAMALRVNGMSHWIMWEITSLFENIGTVQDGMATLTRGPKVQDAPG
AAELVTTGGAVSFDKVSFNYNGERQVLNELTLHIRPGEKVGLVGRSGAGKSTLINLLLRFYDVDKGEIRI
DGQNVAKVTQDSLRSAIGMVTQDTSLLHRSIRDNIAYGRPDATEAQIRAAAASAQADGFISQLSDRQGNS
GYDTLVGERGIKLSGGQRQRIAIARVMLKNAPILLLDEATSALDSEVEVAIQESLDEMMQGKTVIAIAHR
LSTIAAMDRLIVMDEGRIIEQGTHAELLAKQGTYARLWQHQSGGFLGEDRGVAEAVE
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2416260-2414407 Pseudomonas putida F1 chromosome, complete genome
ATGCTGCGTATCTTTGAACGTCGGCTCGACCCCTTCCCACCCGATGAGGTACCACCGCCGCCCGTTGGCC
TGTTGCGCTTCATGTGGGCTTGTACCCGCGGCGCCCGTGGCTACATTCTGGCGCTGGCACTGCTCAGTGC
CGGGGTGTCGATATACGAAGCCTGGCTGTTCGCGTTCCTCGGCCAGGTGGTCGACCTGCTCGCGTCCTGG
CAGGCAGGCGGTACTGTTGGCCCCGAGGAAAGCCGTGTGCTGTGGGGTATCGGCATCGTCCTGCTGGTCA
GCATCGGGCTGGTGGCGCTGCGCACCATGGTTCAGCACCAGGTGCTGGCGATCAACCTGCCGCTGCGGCT
GCGTTGGGATTTTCACCGCCTGATGTTGCGCCAGAGCTTGTCGTTCTTTTCTGACGAGTTTTCTGGCCGG
GTCACAACCAAGGTGATGCAGACGGCACTGGCAGTGCGCGATGTGCTGTTCACCCTTATCGAAATCCTGC
CGGGGATTGGCGTGTATTTCATCGCGATCATTGCCCTGGCCGGTGGCTTTGCCCTGAAACTGATGCTGCC
CTTCATTGCCTGGGTCGTGCTGTTCGGCTTGGCGATGCTGTATTTCGTACCCCGGCTGGGCAAAGTCGGG
CAGGAGCAGGCCAATGCCCGGTCGTCGATGACCGGGCGGGTTTCTGACGCTTACACCAACATCACCACGG
TGAAACTGTTTTCGCACTCCAACCGCGAAGCGCACTTTGCGCGCGCAGCCATGGAAGACTTCAAGCAGAC
CGGTTTTCGCCAGATGCGCCTGGTGAGCCAGTTCGAAATCGTCAACCAGGCGCTGGTGGTGGGCTTGATC
TTTGGTGCCGGTGGCTATGCACTGTGGCTGTGGCACCAGGGCCAGGTCGGCACCGGGGCCGTGGCGGCAA
TCACCGCCATGGCCTTGCGCGTCAACGGCATGTCGCACTGGATCATGTGGGAAATTACCTCGCTGTTCGA
AAACATCGGCACCGTGCAGGACGGTATGGCCACCCTCACCCGCGGCCCCAAGGTACAGGATGCGCCGGGT
GCTGCAGAGCTGGTCACCACGGGTGGCGCGGTGAGTTTCGACAAGGTCAGCTTCAACTACAACGGCGAGC
GCCAGGTGCTCAATGAGCTGACGCTACACATTCGTCCGGGCGAAAAAGTCGGCCTGGTCGGCCGCTCCGG
CGCCGGCAAGTCCACCTTGATCAACCTGCTGCTGCGCTTCTACGACGTGGACAAGGGGGAAATACGCATC
GACGGGCAGAACGTCGCCAAGGTCACGCAAGACAGCCTGCGCAGCGCCATCGGCATGGTCACTCAGGACA
CCTCGCTGTTGCACCGTTCGATTCGCGACAACATTGCCTATGGCCGCCCCGATGCTACCGAGGCACAGAT
CCGTGCCGCTGCGGCCAGTGCCCAGGCCGACGGTTTCATCAGCCAGCTCAGCGACCGCCAGGGCAACAGC
GGTTATGACACCCTGGTGGGTGAACGCGGTATCAAGCTGTCTGGCGGCCAACGCCAGCGCATTGCAATTG
CCCGGGTGATGCTGAAGAACGCACCGATCCTGCTGCTTGACGAAGCCACCAGCGCGCTGGACTCGGAGGT
GGAAGTGGCCATTCAGGAAAGCCTGGATGAGATGATGCAGGGCAAGACCGTTATCGCCATCGCCCACCGG
TTGTCGACGATCGCCGCCATGGACCGGCTGATCGTGATGGATGAAGGGCGCATCATCGAGCAAGGCACCC
ATGCCGAACTGTTGGCAAAACAGGGTACCTATGCACGGTTGTGGCAGCACCAGAGTGGCGGGTTCCTGGG
TGAGGATCGGGGCGTGGCCGAGGCTGTGGAGTAA