SecReT6
Protein ID: 148547835
SecReT6 ID212
T6SS typei4b
Gene symbol-
Locus tagPput_2618
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T6SS(s) in this replicon]
Location [Strand]2986840..2988696 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDA5W3P3
KEGG IDppf:Pput_2618
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-80, Aligned region: 38..347
Phage_base_V [PF04717], Evalue: 1.00E-23, Aligned region: 381..474
Gp5_C [PF06715], Evalue: 5.90E-06, Aligned region: 525..547
Gp5_C [PF06715], Evalue: 5.90E-06, Aligned region: 553..565
DUF2345 [PF10106], Evalue: 0.00048, Aligned region: 564..612
Protein Sequence: 618 a.a.     [Download]
>gi|148547835|ref|YP_001267937.1| unnamed protein product [Pseudomonas putida F1]
MIMDLASALLSPQNRRLFKFHNLANPEQELLLETFKGTEALSRAFNYELLLVCEDSGVPLKSMMGQHVSI
EIELAEGGPRYITGYLTRFASIGSDGGMARYTATLNPWFSMLKNRFDTRIFQGNTVEEVVTEVFALCPAF
SRHEFRLTRPQKRYTYITQYRETDFNFVQRLLEEEGMFYYFEHTAEGHTMIICDDSSTLVAIPEQPQIRF
HSASVTETADSITQWSGNRQLQSGKMATQTFDYRQPNNRLPVALNSVNNQGDVENFEIYDFPGQYTHGTY
DEGETLLRLRIEALELRGKKFEGASNCRAMKPGYTFELLQHYIHDQGPVEDRQFLLMSVESEGHNNYLTG
QQASYFNTFSCVRKKIPFRPQLSTPKPTIAGPQTAIIVGPPGEEIFTDELGRVKIQFHWDRNGKYNDHSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSTNTPPWSLPANKTQSGFLTRSMK
GDGGTANFFRFEDKAGAEQIIMHAERNMDTEIELDETHDVGNNRSITVGGTHTETVKKDTVVQVTEGSYT
LQVDNQFIQVAAKQHIILQVGDSSITLTPEGIEIKGKVIVTTSTDTTQITGAAVRIND
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|148545259|ref|NC_009512.1|:c2988696-2986840 Pseudomonas putida F1 chromosome, complete genome
ATGATCATGGACTTGGCCTCCGCGCTGCTGTCGCCACAGAACCGCCGCCTGTTCAAGTTTCACAACCTCG
CCAACCCCGAGCAGGAGCTGCTGCTGGAAACCTTCAAGGGCACCGAAGCCCTGTCGCGGGCGTTCAACTA
CGAACTGCTGCTGGTCTGCGAAGACTCCGGCGTGCCGCTCAAATCCATGATGGGCCAGCACGTCAGCATC
GAAATCGAACTGGCCGAAGGCGGCCCGCGGTACATAACCGGCTACCTCACACGCTTTGCCAGCATCGGCA
GCGACGGCGGCATGGCACGCTATACCGCCACCCTCAACCCGTGGTTCTCGATGCTGAAGAACCGCTTCGA
CACGCGGATCTTCCAGGGCAACACGGTCGAGGAAGTGGTTACCGAAGTGTTCGCCCTGTGCCCGGCGTTT
TCCCGCCACGAGTTTCGCCTGACCCGGCCACAGAAGCGCTACACGTACATCACCCAGTACCGCGAAACCG
ACTTCAACTTCGTCCAGCGCCTGCTGGAGGAAGAGGGGATGTTCTACTACTTCGAGCACACCGCCGAAGG
CCACACCATGATCATCTGCGATGACTCCAGCACGCTGGTGGCCATCCCCGAGCAACCGCAAATCCGCTTC
CACAGCGCCTCCGTCACCGAGACCGCCGACTCCATCACCCAGTGGAGCGGCAACCGTCAACTGCAATCCG
GCAAGATGGCCACGCAAACCTTTGACTACCGCCAACCGAACAACCGCCTGCCGGTGGCGCTGAACAGCGT
GAACAATCAGGGCGATGTCGAGAACTTCGAGATCTACGACTTCCCCGGCCAGTACACCCACGGTACCTAT
GACGAAGGCGAAACCCTGCTGCGCCTGCGCATTGAGGCGCTGGAGCTGCGCGGCAAAAAGTTTGAAGGCG
CCAGCAACTGCCGGGCCATGAAGCCGGGCTACACCTTCGAACTGCTGCAGCACTACATCCACGACCAGGG
GCCGGTAGAAGACCGTCAGTTCCTGCTGATGAGCGTGGAAAGCGAAGGCCACAACAACTACCTTACCGGC
CAGCAGGCCAGCTACTTCAACACCTTCAGTTGCGTGCGCAAGAAGATCCCGTTCCGCCCGCAACTGAGTA
CGCCCAAACCGACCATTGCCGGCCCGCAGACCGCGATCATCGTCGGCCCACCGGGTGAGGAGATCTTCAC
CGACGAACTGGGCCGGGTGAAAATCCAGTTCCACTGGGACCGCAATGGCAAGTACAACGACCACAGCTCG
TGCTGGGTACGTGTCGCCCAGTCCGGTGCCAGCGGTGGCTTCGGTAGCATCCAGATTCCGCGCGTAGGCG
ACGAAGTGGTGGTGGTGTTCCTCGACGGCAACCCGGACCGGCCGCTGATCATGGGCAGCCTGTACAACAG
CACCAACACCCCGCCATGGTCGCTGCCGGCGAACAAGACCCAGAGTGGGTTCCTGACGCGGTCGATGAAG
GGCGACGGCGGTACCGCCAACTTCTTCCGCTTCGAGGACAAGGCCGGCGCCGAGCAGATCATCATGCATG
CCGAGCGCAACATGGATACCGAGATCGAGCTGGATGAGACCCATGATGTGGGGAATAACCGCTCGATTAC
TGTTGGTGGTACGCACACCGAAACGGTCAAGAAAGACACCGTGGTGCAGGTGACCGAAGGTTCCTACACC
CTGCAGGTCGACAACCAGTTCATCCAGGTGGCCGCCAAGCAGCACATCATCCTGCAGGTGGGCGACAGCA
GCATCACGCTGACCCCGGAAGGCATCGAGATCAAAGGCAAGGTCATCGTGACCACCAGTACCGACACCAC
CCAGATCACCGGCGCCGCAGTGCGGATCAACGACTGA